Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JCK5

Protein Details
Accession A0A367JCK5    Localization Confidence High Confidence Score 22.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MSAQVVKKTQPSRKGKKAWRKNVDISDVTHydrophilic
113-143IQKILKRKGNQQTQSQPKKKKVNDKKTYDLWHydrophilic
251-280DDQETKKMKAAKRKTRRERHKKFRLASEELBasic
383-416VPVTPTRRYKLKEYEKRSYKKFDQMEQMKKNQKRHydrophilic
NLS Segment(s)
PositionSequence
12-20SRKGKKAWR
256-290KKMKAAKRKTRRERHKKFRLASEELARKQKLHEKA
319-333KEERKASEEKKGIKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0000027  P:ribosomal large subunit assembly  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MSAQVVKKTQPSRKGKKAWRKNVDISDVTEGQEELRAVERFIGHTGEIKDEELFTIDTAGDLNVKRQLAKDKPLRVDEILQQRSAVPAVQPKNPFKKQEITDKVASKHESDNIQKILKRKGNQQTQSQPKKKKVNDKKTYDLWGQEEPEPINDFLPTQQKPKTPETIKQKPAAAAHIPAIETPHAGASYNPEAEQHQQLLAEAVKAEERKAEIIAKLHEQLSYREELKLLASEDAPMEHEDDEDVQDLPTDDQETKKMKAAKRKTRRERHKKFRLASEELARKQKLHEKAIRRQIDQLREIEAEIEQRANELDALLEKKEERKASEEKKGIKKLGKYEVPELPIDVQLTDELCATLRQLKPEGSIFKDRFHSLVKRNIIEPRVPVTPTRRYKLKEYEKRSYKKFDQMEQMKKNQKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.9
4 0.92
5 0.93
6 0.92
7 0.91
8 0.9
9 0.87
10 0.84
11 0.76
12 0.68
13 0.64
14 0.55
15 0.46
16 0.38
17 0.29
18 0.22
19 0.22
20 0.18
21 0.12
22 0.16
23 0.16
24 0.16
25 0.19
26 0.19
27 0.18
28 0.2
29 0.2
30 0.15
31 0.2
32 0.21
33 0.22
34 0.22
35 0.21
36 0.2
37 0.19
38 0.19
39 0.15
40 0.14
41 0.1
42 0.1
43 0.09
44 0.08
45 0.08
46 0.08
47 0.1
48 0.1
49 0.12
50 0.16
51 0.17
52 0.18
53 0.21
54 0.3
55 0.33
56 0.43
57 0.49
58 0.53
59 0.59
60 0.61
61 0.62
62 0.55
63 0.53
64 0.51
65 0.52
66 0.47
67 0.4
68 0.37
69 0.33
70 0.32
71 0.28
72 0.21
73 0.13
74 0.19
75 0.22
76 0.28
77 0.35
78 0.42
79 0.51
80 0.56
81 0.58
82 0.55
83 0.6
84 0.59
85 0.63
86 0.63
87 0.59
88 0.6
89 0.6
90 0.58
91 0.55
92 0.52
93 0.43
94 0.39
95 0.37
96 0.36
97 0.35
98 0.39
99 0.37
100 0.4
101 0.39
102 0.41
103 0.46
104 0.47
105 0.46
106 0.5
107 0.56
108 0.62
109 0.65
110 0.69
111 0.7
112 0.74
113 0.82
114 0.81
115 0.8
116 0.79
117 0.83
118 0.81
119 0.82
120 0.83
121 0.83
122 0.84
123 0.83
124 0.81
125 0.76
126 0.74
127 0.66
128 0.58
129 0.49
130 0.42
131 0.37
132 0.32
133 0.3
134 0.24
135 0.23
136 0.22
137 0.19
138 0.16
139 0.13
140 0.12
141 0.12
142 0.19
143 0.19
144 0.21
145 0.25
146 0.28
147 0.34
148 0.38
149 0.44
150 0.41
151 0.47
152 0.53
153 0.58
154 0.59
155 0.58
156 0.56
157 0.5
158 0.47
159 0.43
160 0.35
161 0.26
162 0.23
163 0.2
164 0.18
165 0.15
166 0.15
167 0.11
168 0.09
169 0.08
170 0.07
171 0.06
172 0.06
173 0.06
174 0.09
175 0.11
176 0.12
177 0.11
178 0.12
179 0.13
180 0.15
181 0.17
182 0.13
183 0.11
184 0.1
185 0.1
186 0.11
187 0.1
188 0.08
189 0.06
190 0.06
191 0.07
192 0.07
193 0.07
194 0.07
195 0.07
196 0.08
197 0.09
198 0.1
199 0.1
200 0.12
201 0.13
202 0.14
203 0.15
204 0.15
205 0.15
206 0.15
207 0.15
208 0.15
209 0.16
210 0.16
211 0.14
212 0.14
213 0.13
214 0.12
215 0.12
216 0.11
217 0.09
218 0.08
219 0.08
220 0.08
221 0.08
222 0.09
223 0.08
224 0.08
225 0.07
226 0.07
227 0.07
228 0.07
229 0.08
230 0.07
231 0.07
232 0.06
233 0.06
234 0.07
235 0.07
236 0.07
237 0.08
238 0.07
239 0.08
240 0.14
241 0.17
242 0.18
243 0.22
244 0.28
245 0.31
246 0.41
247 0.5
248 0.56
249 0.64
250 0.74
251 0.8
252 0.85
253 0.92
254 0.94
255 0.94
256 0.94
257 0.94
258 0.93
259 0.87
260 0.86
261 0.82
262 0.77
263 0.71
264 0.68
265 0.65
266 0.6
267 0.61
268 0.52
269 0.45
270 0.43
271 0.46
272 0.44
273 0.45
274 0.49
275 0.51
276 0.6
277 0.69
278 0.71
279 0.65
280 0.66
281 0.64
282 0.63
283 0.58
284 0.5
285 0.43
286 0.38
287 0.36
288 0.29
289 0.22
290 0.17
291 0.14
292 0.13
293 0.09
294 0.09
295 0.09
296 0.09
297 0.08
298 0.07
299 0.06
300 0.08
301 0.1
302 0.1
303 0.11
304 0.12
305 0.16
306 0.22
307 0.24
308 0.24
309 0.29
310 0.38
311 0.44
312 0.53
313 0.56
314 0.6
315 0.66
316 0.71
317 0.72
318 0.68
319 0.66
320 0.64
321 0.67
322 0.64
323 0.59
324 0.58
325 0.56
326 0.53
327 0.47
328 0.41
329 0.33
330 0.28
331 0.24
332 0.18
333 0.14
334 0.12
335 0.12
336 0.11
337 0.09
338 0.08
339 0.08
340 0.08
341 0.09
342 0.16
343 0.17
344 0.21
345 0.24
346 0.25
347 0.28
348 0.34
349 0.38
350 0.36
351 0.44
352 0.42
353 0.44
354 0.47
355 0.45
356 0.41
357 0.43
358 0.45
359 0.42
360 0.5
361 0.52
362 0.51
363 0.53
364 0.58
365 0.56
366 0.51
367 0.47
368 0.43
369 0.39
370 0.38
371 0.39
372 0.39
373 0.45
374 0.5
375 0.54
376 0.57
377 0.58
378 0.65
379 0.71
380 0.76
381 0.76
382 0.76
383 0.8
384 0.83
385 0.87
386 0.85
387 0.84
388 0.8
389 0.8
390 0.78
391 0.75
392 0.75
393 0.77
394 0.8
395 0.79
396 0.81