Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367IZH5

Protein Details
Accession A0A367IZH5    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
88-114DITMDTERCKKQKKKPHNPPQSIPLPIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences YVEKYINLPRVLELTGPKRKGESEASYMTRFLTIRRQLVCCYPGKAWNDSADRMQDLQSIVDDWSQHENLTQPITLKIYGAKITGKEDITMDTERCKKQKKKPHNPPQSIPLPIPDKCPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.37
3 0.38
4 0.37
5 0.37
6 0.37
7 0.39
8 0.4
9 0.36
10 0.33
11 0.38
12 0.41
13 0.4
14 0.39
15 0.35
16 0.3
17 0.24
18 0.2
19 0.23
20 0.25
21 0.29
22 0.32
23 0.33
24 0.33
25 0.37
26 0.39
27 0.32
28 0.3
29 0.26
30 0.29
31 0.3
32 0.3
33 0.27
34 0.29
35 0.3
36 0.28
37 0.28
38 0.23
39 0.21
40 0.19
41 0.18
42 0.14
43 0.12
44 0.1
45 0.09
46 0.08
47 0.08
48 0.08
49 0.08
50 0.07
51 0.1
52 0.1
53 0.1
54 0.1
55 0.11
56 0.11
57 0.12
58 0.11
59 0.09
60 0.1
61 0.12
62 0.11
63 0.1
64 0.11
65 0.11
66 0.12
67 0.13
68 0.13
69 0.13
70 0.15
71 0.19
72 0.18
73 0.16
74 0.16
75 0.16
76 0.18
77 0.19
78 0.17
79 0.2
80 0.27
81 0.31
82 0.38
83 0.46
84 0.52
85 0.6
86 0.7
87 0.76
88 0.81
89 0.87
90 0.92
91 0.93
92 0.92
93 0.88
94 0.86
95 0.82
96 0.75
97 0.64
98 0.61
99 0.55
100 0.47