Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IU75

Protein Details
Accession A0A367IU75    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
44-68EELIKQYSKNNHHRRRRNSNSSISSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003428  MAM33  
IPR036561  MAM33_sf  
Gene Ontology GO:0005759  C:mitochondrial matrix  
Pfam View protein in Pfam  
PF02330  MAM33  
Amino Acid Sequences RYLEERGINSALANFLPDYIEYKEQKEYIQWLDNMKNTLIAHEEELIKQYSKNNHHRRRRNSNSSISSDDLAAIHLDLMSSSSSRPLLLSDSSSVASSQSIETPRLLHKITWNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.09
5 0.11
6 0.14
7 0.2
8 0.2
9 0.23
10 0.26
11 0.26
12 0.26
13 0.25
14 0.26
15 0.25
16 0.28
17 0.27
18 0.28
19 0.31
20 0.32
21 0.32
22 0.27
23 0.26
24 0.21
25 0.2
26 0.18
27 0.15
28 0.13
29 0.14
30 0.14
31 0.11
32 0.13
33 0.13
34 0.12
35 0.12
36 0.15
37 0.2
38 0.28
39 0.38
40 0.48
41 0.57
42 0.66
43 0.75
44 0.81
45 0.85
46 0.86
47 0.85
48 0.81
49 0.8
50 0.75
51 0.7
52 0.64
53 0.54
54 0.44
55 0.34
56 0.28
57 0.19
58 0.14
59 0.1
60 0.06
61 0.05
62 0.04
63 0.04
64 0.03
65 0.04
66 0.04
67 0.05
68 0.05
69 0.07
70 0.07
71 0.08
72 0.08
73 0.08
74 0.1
75 0.11
76 0.14
77 0.13
78 0.15
79 0.15
80 0.16
81 0.15
82 0.12
83 0.11
84 0.1
85 0.1
86 0.13
87 0.14
88 0.16
89 0.16
90 0.19
91 0.22
92 0.26
93 0.27
94 0.25