Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1D182

Protein Details
Accession A1D182    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
27-46LYECDCRKYLKRKNEDVQLEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 19, cyto_nucl 12.5, nucl 4, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011057  Mss4-like_sf  
IPR011323  Mss4/transl-control_tumour  
IPR034737  TCTP  
IPR018103  Translation_control_tumour_CS  
IPR018105  Translational_control_tumour_p  
KEGG nfi:NFIA_008520  -  
Pfam View protein in Pfam  
PF00838  TCTP  
PROSITE View protein in PROSITE  
PS01002  TCTP_1  
PS51797  TCTP_3  
Amino Acid Sequences MIIYKDIISGDEVLSDNFKIKEVDGVLYECDCRKYLKRKNEDVQLEGANPSAEGGDEDAGGEGEEVMVHDIEDQFRLVWLKTEEGMKPSKDAFKSHLKVYMKKVLAKLQEKGAPAAEIEAFKKGAPAAVKKILANYDNYDVLMGLSMDGDAMHVLIDFREDGVTPYATLWKHGLEEMKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.13
5 0.15
6 0.13
7 0.13
8 0.17
9 0.17
10 0.18
11 0.17
12 0.18
13 0.18
14 0.18
15 0.19
16 0.15
17 0.16
18 0.15
19 0.18
20 0.25
21 0.34
22 0.43
23 0.52
24 0.6
25 0.68
26 0.75
27 0.8
28 0.76
29 0.68
30 0.62
31 0.53
32 0.45
33 0.35
34 0.28
35 0.18
36 0.14
37 0.11
38 0.07
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.05
58 0.05
59 0.06
60 0.06
61 0.05
62 0.06
63 0.07
64 0.06
65 0.08
66 0.09
67 0.09
68 0.1
69 0.13
70 0.13
71 0.14
72 0.17
73 0.15
74 0.15
75 0.16
76 0.2
77 0.18
78 0.19
79 0.21
80 0.28
81 0.3
82 0.3
83 0.36
84 0.34
85 0.37
86 0.41
87 0.45
88 0.37
89 0.38
90 0.39
91 0.38
92 0.43
93 0.42
94 0.39
95 0.35
96 0.36
97 0.34
98 0.33
99 0.28
100 0.2
101 0.17
102 0.16
103 0.12
104 0.1
105 0.1
106 0.1
107 0.1
108 0.09
109 0.1
110 0.09
111 0.11
112 0.13
113 0.16
114 0.2
115 0.25
116 0.26
117 0.26
118 0.28
119 0.29
120 0.27
121 0.27
122 0.25
123 0.23
124 0.22
125 0.21
126 0.19
127 0.15
128 0.14
129 0.11
130 0.08
131 0.05
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.03
138 0.03
139 0.03
140 0.03
141 0.04
142 0.04
143 0.05
144 0.05
145 0.06
146 0.06
147 0.07
148 0.09
149 0.12
150 0.12
151 0.12
152 0.13
153 0.17
154 0.17
155 0.19
156 0.19
157 0.17
158 0.18
159 0.21