Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367ITI1

Protein Details
Accession A0A367ITI1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
38-60ILKGIYPREPKNKKKANKGSTAPHydrophilic
NLS Segment(s)
PositionSequence
47-53PKNKKKA
Subcellular Location(s) nucl 16, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010613  PES  
Gene Ontology GO:0005730  C:nucleolus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF06732  Pescadillo_N  
Amino Acid Sequences MGKLIKKGTKGNAANFITRQQALNKLQISLADFRRLCILKGIYPREPKNKKKANKGSTAPATFYYVKDIKYLLHEPLLAKFREHKAFTKKLNKVLHKGEFAAAKSLEENNKPIYSLDHIVKERYPTFIDALRDLDDALSMLFLFAMLPTDDKIKADVVSDCRQLIAEFQGYVMRSKSLRKVFFSIKGIYYQAEIKGQTITWIVPYQFSQNIPTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.52
3 0.48
4 0.42
5 0.38
6 0.34
7 0.28
8 0.33
9 0.33
10 0.39
11 0.37
12 0.33
13 0.32
14 0.32
15 0.32
16 0.3
17 0.29
18 0.3
19 0.29
20 0.29
21 0.35
22 0.34
23 0.32
24 0.32
25 0.31
26 0.28
27 0.37
28 0.42
29 0.43
30 0.5
31 0.56
32 0.61
33 0.68
34 0.71
35 0.73
36 0.78
37 0.78
38 0.81
39 0.85
40 0.83
41 0.83
42 0.78
43 0.76
44 0.75
45 0.68
46 0.58
47 0.49
48 0.45
49 0.37
50 0.33
51 0.3
52 0.24
53 0.23
54 0.22
55 0.21
56 0.17
57 0.21
58 0.23
59 0.18
60 0.17
61 0.18
62 0.18
63 0.22
64 0.25
65 0.2
66 0.19
67 0.22
68 0.26
69 0.31
70 0.33
71 0.35
72 0.39
73 0.45
74 0.53
75 0.58
76 0.57
77 0.6
78 0.65
79 0.63
80 0.61
81 0.61
82 0.57
83 0.48
84 0.45
85 0.38
86 0.32
87 0.28
88 0.25
89 0.18
90 0.14
91 0.13
92 0.14
93 0.15
94 0.13
95 0.14
96 0.14
97 0.14
98 0.14
99 0.13
100 0.13
101 0.13
102 0.15
103 0.15
104 0.18
105 0.19
106 0.2
107 0.2
108 0.22
109 0.2
110 0.19
111 0.19
112 0.15
113 0.16
114 0.18
115 0.19
116 0.17
117 0.17
118 0.17
119 0.15
120 0.14
121 0.12
122 0.09
123 0.07
124 0.06
125 0.05
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.02
132 0.04
133 0.04
134 0.05
135 0.05
136 0.08
137 0.08
138 0.09
139 0.1
140 0.1
141 0.1
142 0.12
143 0.15
144 0.18
145 0.22
146 0.24
147 0.23
148 0.22
149 0.22
150 0.2
151 0.18
152 0.16
153 0.13
154 0.11
155 0.12
156 0.14
157 0.14
158 0.16
159 0.15
160 0.14
161 0.14
162 0.19
163 0.27
164 0.33
165 0.37
166 0.4
167 0.46
168 0.49
169 0.56
170 0.56
171 0.51
172 0.44
173 0.42
174 0.39
175 0.33
176 0.29
177 0.24
178 0.22
179 0.22
180 0.2
181 0.18
182 0.19
183 0.18
184 0.18
185 0.16
186 0.15
187 0.14
188 0.18
189 0.17
190 0.18
191 0.2
192 0.22
193 0.25
194 0.26