Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367JB73

Protein Details
Accession A0A367JB73    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
42-78QCDSCREKRKIKQIHQKCECLLKKKPRLTPTRRIMSIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences MIIINNIKYACEKCIQGHRSSRCDHRERKLVAVRKKGRPISQCDSCREKRKIKQIHQKCECLLKKKPRLTPTRRIMSIEALLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.41
4 0.49
5 0.52
6 0.54
7 0.57
8 0.61
9 0.6
10 0.65
11 0.65
12 0.64
13 0.66
14 0.63
15 0.67
16 0.66
17 0.66
18 0.65
19 0.68
20 0.68
21 0.66
22 0.71
23 0.67
24 0.65
25 0.62
26 0.62
27 0.58
28 0.6
29 0.56
30 0.53
31 0.56
32 0.55
33 0.6
34 0.58
35 0.6
36 0.59
37 0.65
38 0.71
39 0.73
40 0.79
41 0.8
42 0.84
43 0.82
44 0.79
45 0.71
46 0.71
47 0.67
48 0.63
49 0.62
50 0.62
51 0.65
52 0.69
53 0.75
54 0.74
55 0.79
56 0.8
57 0.82
58 0.81
59 0.81
60 0.75
61 0.71
62 0.64
63 0.59