Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JCH6

Protein Details
Accession A0A367JCH6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-24NQQKLKIKSHEANNRPKRKRBasic
NLS Segment(s)
PositionSequence
19-23RPKRK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS50071  HOMEOBOX_2  
Amino Acid Sequences MSYSNQQKLKIKSHEANNRPKRKRITPNQLEVLTSIFERIKTPNYQLREMTARELNMTNREVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.73
3 0.78
4 0.79
5 0.82
6 0.79
7 0.79
8 0.77
9 0.76
10 0.79
11 0.78
12 0.79
13 0.76
14 0.78
15 0.76
16 0.69
17 0.59
18 0.48
19 0.38
20 0.27
21 0.19
22 0.13
23 0.08
24 0.08
25 0.09
26 0.11
27 0.14
28 0.16
29 0.22
30 0.27
31 0.31
32 0.34
33 0.34
34 0.36
35 0.37
36 0.36
37 0.36
38 0.33
39 0.29
40 0.28
41 0.3
42 0.29
43 0.29