Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367J9E9

Protein Details
Accession A0A367J9E9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
91-111AGERRREAMRRKYAARRRERLBasic
NLS Segment(s)
PositionSequence
81-110RMKAIRKAREAGERRREAMRRKYAARRRER
Subcellular Location(s) plas 5E.R. 5, nucl 4, mito 3, cyto 3, vacu 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MRLSSLFILAHIITLALALGEDLEDDSTDDVFEPTYPAQEIGPIAYDFSSVEFEDTEPLTDGVEYMKNQNEEAIMDLMKERMKAIRKAREAGERRREAMRRKYAARRRERLPAYHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.03
4 0.03
5 0.03
6 0.03
7 0.02
8 0.03
9 0.03
10 0.04
11 0.04
12 0.04
13 0.05
14 0.05
15 0.05
16 0.06
17 0.05
18 0.06
19 0.06
20 0.07
21 0.07
22 0.08
23 0.08
24 0.08
25 0.08
26 0.09
27 0.09
28 0.07
29 0.09
30 0.08
31 0.08
32 0.07
33 0.07
34 0.06
35 0.07
36 0.08
37 0.06
38 0.06
39 0.06
40 0.07
41 0.08
42 0.08
43 0.07
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.05
50 0.07
51 0.07
52 0.08
53 0.11
54 0.12
55 0.12
56 0.12
57 0.11
58 0.1
59 0.11
60 0.11
61 0.08
62 0.07
63 0.08
64 0.09
65 0.1
66 0.1
67 0.09
68 0.13
69 0.18
70 0.26
71 0.35
72 0.43
73 0.46
74 0.5
75 0.54
76 0.59
77 0.61
78 0.64
79 0.65
80 0.6
81 0.58
82 0.62
83 0.64
84 0.63
85 0.67
86 0.66
87 0.63
88 0.67
89 0.75
90 0.77
91 0.8
92 0.82
93 0.79
94 0.74
95 0.77
96 0.75