Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IYP1

Protein Details
Accession A0A367IYP1    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
114-144ILHHRESTTRRIPKRKRLRKRSTFREFFEKNBasic
NLS Segment(s)
PositionSequence
123-135RRIPKRKRLRKRS
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MPVVNIPMTELAFNAFYSLHRPLLGLSIPRPFMAGNMVGQITKEEDNPEEALMNYMATLKPFHPPPSPQHDASIENKTTTTLTVEIDPSYFFNHNIYHEEMTDYLTAIQKELDILHHRESTTRRIPKRKRLRKRSTFREFFEKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.13
5 0.16
6 0.15
7 0.14
8 0.15
9 0.14
10 0.17
11 0.2
12 0.18
13 0.17
14 0.21
15 0.21
16 0.21
17 0.21
18 0.18
19 0.16
20 0.16
21 0.15
22 0.1
23 0.11
24 0.12
25 0.11
26 0.11
27 0.11
28 0.1
29 0.1
30 0.1
31 0.1
32 0.11
33 0.13
34 0.14
35 0.13
36 0.12
37 0.11
38 0.11
39 0.09
40 0.08
41 0.06
42 0.07
43 0.06
44 0.06
45 0.08
46 0.07
47 0.11
48 0.12
49 0.16
50 0.18
51 0.21
52 0.25
53 0.33
54 0.37
55 0.34
56 0.35
57 0.33
58 0.33
59 0.34
60 0.34
61 0.25
62 0.22
63 0.21
64 0.19
65 0.17
66 0.14
67 0.12
68 0.08
69 0.08
70 0.09
71 0.1
72 0.09
73 0.09
74 0.09
75 0.08
76 0.11
77 0.11
78 0.1
79 0.11
80 0.12
81 0.14
82 0.16
83 0.19
84 0.17
85 0.16
86 0.17
87 0.16
88 0.16
89 0.14
90 0.12
91 0.1
92 0.12
93 0.11
94 0.11
95 0.1
96 0.09
97 0.09
98 0.09
99 0.13
100 0.15
101 0.19
102 0.22
103 0.25
104 0.25
105 0.29
106 0.32
107 0.36
108 0.41
109 0.47
110 0.53
111 0.61
112 0.71
113 0.78
114 0.86
115 0.89
116 0.9
117 0.92
118 0.94
119 0.94
120 0.95
121 0.95
122 0.95
123 0.92
124 0.87