Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367J2W7

Protein Details
Accession A0A367J2W7    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
40-70LMGKPEHKIFKRNKRTQKNKMTSKYFRQQALHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, nucl 8, mito 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MVYAYDKEILGAVWEFAKNFDKASPLGFSQWLNEQDIGVLMGKPEHKIFKRNKRTQKNKMTSKYFRQQALP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.15
5 0.13
6 0.14
7 0.14
8 0.15
9 0.15
10 0.16
11 0.16
12 0.14
13 0.15
14 0.15
15 0.14
16 0.13
17 0.18
18 0.17
19 0.16
20 0.16
21 0.14
22 0.12
23 0.12
24 0.11
25 0.07
26 0.06
27 0.04
28 0.06
29 0.07
30 0.08
31 0.1
32 0.16
33 0.18
34 0.26
35 0.37
36 0.46
37 0.57
38 0.66
39 0.75
40 0.8
41 0.89
42 0.91
43 0.93
44 0.92
45 0.92
46 0.91
47 0.9
48 0.88
49 0.87
50 0.86
51 0.81