Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367KA73

Protein Details
Accession A0A367KA73    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-78RRRGKLFVTCSKNKKHKQRQGBasic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 12, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MSFLTNFTKTAFQQFTRQQQPTLALWQQTNNSFMYNVVRTMKVRSSVKKLCDGCTTVRRRGKLFVTCSKNKKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.55
4 0.56
5 0.48
6 0.46
7 0.48
8 0.41
9 0.4
10 0.33
11 0.26
12 0.25
13 0.26
14 0.27
15 0.24
16 0.24
17 0.18
18 0.16
19 0.14
20 0.14
21 0.15
22 0.13
23 0.13
24 0.13
25 0.13
26 0.13
27 0.16
28 0.17
29 0.2
30 0.24
31 0.26
32 0.33
33 0.37
34 0.4
35 0.46
36 0.46
37 0.43
38 0.42
39 0.41
40 0.38
41 0.43
42 0.46
43 0.46
44 0.5
45 0.5
46 0.49
47 0.52
48 0.54
49 0.52
50 0.54
51 0.55
52 0.58
53 0.64
54 0.69
55 0.73
56 0.76
57 0.78
58 0.82