Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367K9T5

Protein Details
Accession A0A367K9T5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
72-93AGQIQKRRFPFRRPRQAPPAAAHydrophilic
NLS Segment(s)
PositionSequence
78-94RRFPFRRPRQAPPAAAA
Subcellular Location(s) extr 24, vacu 2
Family & Domain DBs
Amino Acid Sequences MQIKLVILTICASFAAIGFAAPPPPQQGTGPSDALVPGGDPIPATNDPSAPALDGNYPGAELTEGQPTQSPAGQIQKRRFPFRRPRQAPPAAAAPKAPAPSAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.05
4 0.05
5 0.05
6 0.06
7 0.07
8 0.08
9 0.09
10 0.1
11 0.12
12 0.13
13 0.13
14 0.17
15 0.2
16 0.23
17 0.23
18 0.21
19 0.19
20 0.18
21 0.17
22 0.13
23 0.09
24 0.05
25 0.05
26 0.05
27 0.04
28 0.04
29 0.08
30 0.09
31 0.1
32 0.1
33 0.1
34 0.11
35 0.12
36 0.12
37 0.08
38 0.08
39 0.07
40 0.07
41 0.07
42 0.07
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.1
51 0.1
52 0.1
53 0.11
54 0.12
55 0.13
56 0.14
57 0.13
58 0.12
59 0.21
60 0.26
61 0.32
62 0.38
63 0.46
64 0.51
65 0.6
66 0.63
67 0.64
68 0.71
69 0.75
70 0.79
71 0.77
72 0.81
73 0.81
74 0.84
75 0.77
76 0.7
77 0.68
78 0.6
79 0.54
80 0.46
81 0.39
82 0.35
83 0.33