Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JY73

Protein Details
Accession A0A367JY73    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-46KVKSQTPKVAKQEKKKPKTGRAKKRQIYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
11-37AGKVKSQTPKVAKQEKKKPKTGRAKKR
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVAKQEKKKPKTGRAKKRQIYNRRFVNVTTQIGGKRRMNPAPTQGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.45
4 0.48
5 0.52
6 0.6
7 0.64
8 0.69
9 0.71
10 0.73
11 0.77
12 0.79
13 0.8
14 0.81
15 0.8
16 0.8
17 0.84
18 0.84
19 0.85
20 0.85
21 0.88
22 0.84
23 0.85
24 0.85
25 0.85
26 0.83
27 0.81
28 0.78
29 0.71
30 0.67
31 0.58
32 0.56
33 0.52
34 0.45
35 0.37
36 0.32
37 0.32
38 0.34
39 0.4
40 0.36
41 0.36
42 0.41
43 0.47
44 0.48
45 0.5