Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367K6B4

Protein Details
Accession A0A367K6B4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
73-95HVMKPLKIEKRGRKPKSGQYYSVHydrophilic
NLS Segment(s)
PositionSequence
79-88KIEKRGRKPK
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MGQVKTITMTIDTISTLATTKDISSVKPTLPSIRSLKLLPPQKDDDVKVIQCKPKTFRTVSDNWTFITPMDHHVMKPLKIEKRGRKPKSGQYYSVWNPRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.07
5 0.07
6 0.07
7 0.07
8 0.12
9 0.13
10 0.13
11 0.18
12 0.2
13 0.2
14 0.23
15 0.24
16 0.25
17 0.26
18 0.3
19 0.29
20 0.29
21 0.3
22 0.28
23 0.3
24 0.33
25 0.39
26 0.36
27 0.37
28 0.38
29 0.39
30 0.41
31 0.38
32 0.35
33 0.3
34 0.29
35 0.29
36 0.29
37 0.3
38 0.29
39 0.31
40 0.31
41 0.33
42 0.38
43 0.36
44 0.36
45 0.39
46 0.42
47 0.44
48 0.45
49 0.4
50 0.35
51 0.34
52 0.29
53 0.22
54 0.2
55 0.16
56 0.14
57 0.17
58 0.17
59 0.16
60 0.23
61 0.27
62 0.24
63 0.3
64 0.34
65 0.37
66 0.44
67 0.55
68 0.58
69 0.66
70 0.76
71 0.77
72 0.79
73 0.81
74 0.83
75 0.84
76 0.8
77 0.74
78 0.67
79 0.71
80 0.68
81 0.71