Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367J2G2

Protein Details
Accession A0A367J2G2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
106-126LCQQPDHRPPTKKQKVNKNKQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 13.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003349  JmjN  
Pfam View protein in Pfam  
PF02375  JmjN  
PROSITE View protein in PROSITE  
PS51183  JMJN  
Amino Acid Sequences MKIQPSGYYDQENGGTIPIFTPTMEEFKDFKVFMEAIDEYGKKAGIVKIVPPKEWSEQLPGLIADKINDIKIRRPITQHILGNNGIFSQTNVEKRGTFTVNQWFELCQQPDHRPPTKKQKVNKNKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.11
4 0.11
5 0.1
6 0.09
7 0.08
8 0.1
9 0.1
10 0.14
11 0.14
12 0.17
13 0.17
14 0.2
15 0.24
16 0.21
17 0.2
18 0.2
19 0.2
20 0.16
21 0.19
22 0.17
23 0.14
24 0.17
25 0.17
26 0.13
27 0.14
28 0.14
29 0.09
30 0.11
31 0.11
32 0.11
33 0.12
34 0.17
35 0.25
36 0.26
37 0.27
38 0.27
39 0.29
40 0.28
41 0.29
42 0.26
43 0.22
44 0.22
45 0.21
46 0.2
47 0.17
48 0.15
49 0.13
50 0.12
51 0.07
52 0.07
53 0.08
54 0.08
55 0.11
56 0.11
57 0.15
58 0.22
59 0.25
60 0.26
61 0.29
62 0.33
63 0.37
64 0.43
65 0.41
66 0.35
67 0.35
68 0.34
69 0.31
70 0.26
71 0.2
72 0.13
73 0.1
74 0.09
75 0.1
76 0.13
77 0.16
78 0.18
79 0.19
80 0.2
81 0.22
82 0.27
83 0.25
84 0.23
85 0.24
86 0.32
87 0.33
88 0.34
89 0.32
90 0.28
91 0.28
92 0.35
93 0.32
94 0.27
95 0.3
96 0.35
97 0.43
98 0.5
99 0.56
100 0.55
101 0.62
102 0.69
103 0.75
104 0.76
105 0.77
106 0.81