Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367J0N8

Protein Details
Accession A0A367J0N8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-35HNYNEPKKEESSKKPKPKLSRKRKTGNSEVPKGBasic
NLS Segment(s)
PositionSequence
9-41KKEESSKKPKPKLSRKRKTGNSEVPKGSHKRAR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences SLHNYNEPKKEESSKKPKPKLSRKRKTGNSEVPKGSHKRARPNASDLASTSAAQPTPAPPNQPSATAVQPAVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.81
4 0.84
5 0.86
6 0.88
7 0.89
8 0.89
9 0.89
10 0.88
11 0.9
12 0.91
13 0.88
14 0.87
15 0.86
16 0.83
17 0.79
18 0.71
19 0.62
20 0.59
21 0.53
22 0.48
23 0.43
24 0.39
25 0.43
26 0.5
27 0.55
28 0.53
29 0.54
30 0.55
31 0.51
32 0.48
33 0.38
34 0.34
35 0.28
36 0.24
37 0.2
38 0.16
39 0.14
40 0.13
41 0.13
42 0.12
43 0.18
44 0.19
45 0.23
46 0.22
47 0.29
48 0.3
49 0.32
50 0.31
51 0.28
52 0.29
53 0.28
54 0.27