Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JTC9

Protein Details
Accession A0A367JTC9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
119-157ASKHTKTTTKKTTKKTTKKTTKKTTKKTKTTKKGTASAVHydrophilic
174-217HSIPKPVAASHKKKKHTTTKKHTVAKKKKTTKKTTKKPKKAVTABasic
NLS Segment(s)
PositionSequence
127-151TKKTTKKTTKKTTKKTTKKTKTTKK
182-214ASHKKKKHTTTKKHTVAKKKKTTKKTTKKPKKA
Subcellular Location(s) extr 24, mito 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR018466  Kre9/Knh1-like_N  
Pfam View protein in Pfam  
PF10342  Kre9_KNH  
Amino Acid Sequences MVNKSSLIFLSLTAALDLVLASSVQITSPKVNAVYEAGSTVDIKWHVNDKSAGPIRLQYASGKASSLNVDGVIADNVDASLGTYKWTIPKDIKPKKYVLEAGPNAKDLSFQGYITIKNASKHTKTTTKKTTKKTTKKTTKKTTKKTKTTKKGTASAVCIGYPSEQDKGEYVRCHSIPKPVAASHKKKKHTTTKKHTVAKKKKTTKKTTKKPKKAVTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.09
4 0.08
5 0.05
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.07
13 0.09
14 0.1
15 0.12
16 0.14
17 0.15
18 0.15
19 0.15
20 0.16
21 0.15
22 0.13
23 0.13
24 0.11
25 0.11
26 0.11
27 0.1
28 0.11
29 0.11
30 0.11
31 0.13
32 0.18
33 0.18
34 0.21
35 0.23
36 0.21
37 0.3
38 0.34
39 0.34
40 0.28
41 0.3
42 0.29
43 0.28
44 0.28
45 0.2
46 0.18
47 0.19
48 0.18
49 0.16
50 0.14
51 0.14
52 0.14
53 0.13
54 0.1
55 0.08
56 0.08
57 0.08
58 0.08
59 0.07
60 0.06
61 0.05
62 0.04
63 0.04
64 0.04
65 0.03
66 0.03
67 0.04
68 0.04
69 0.05
70 0.06
71 0.06
72 0.11
73 0.12
74 0.15
75 0.17
76 0.25
77 0.35
78 0.44
79 0.5
80 0.49
81 0.52
82 0.51
83 0.52
84 0.49
85 0.41
86 0.41
87 0.37
88 0.38
89 0.36
90 0.34
91 0.3
92 0.25
93 0.22
94 0.13
95 0.15
96 0.11
97 0.1
98 0.11
99 0.12
100 0.12
101 0.13
102 0.16
103 0.13
104 0.14
105 0.18
106 0.21
107 0.22
108 0.25
109 0.29
110 0.36
111 0.39
112 0.46
113 0.54
114 0.59
115 0.65
116 0.71
117 0.77
118 0.78
119 0.84
120 0.86
121 0.86
122 0.87
123 0.9
124 0.91
125 0.92
126 0.92
127 0.92
128 0.92
129 0.92
130 0.92
131 0.92
132 0.93
133 0.92
134 0.92
135 0.91
136 0.9
137 0.85
138 0.81
139 0.77
140 0.71
141 0.63
142 0.57
143 0.48
144 0.38
145 0.32
146 0.25
147 0.19
148 0.16
149 0.15
150 0.13
151 0.13
152 0.14
153 0.15
154 0.18
155 0.22
156 0.22
157 0.24
158 0.28
159 0.29
160 0.33
161 0.33
162 0.38
163 0.37
164 0.38
165 0.39
166 0.36
167 0.45
168 0.51
169 0.59
170 0.61
171 0.67
172 0.71
173 0.75
174 0.81
175 0.82
176 0.84
177 0.85
178 0.85
179 0.88
180 0.89
181 0.91
182 0.9
183 0.9
184 0.9
185 0.89
186 0.89
187 0.89
188 0.89
189 0.91
190 0.93
191 0.93
192 0.94
193 0.94
194 0.94
195 0.95
196 0.96
197 0.96