Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367K4C6

Protein Details
Accession A0A367K4C6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-45EKLKHRNKYPNYKYSPRQKNKQSLEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MWRSEKEEVRSYYHRLAEEEKLKHRNKYPNYKYSPRQKNKQSLEDLGRRFVSTSANQIENNQPIHQEAQIDFEFNITTPPSLMIRDLQEYRDGSSLDILSLDCDLYTLLSFLPEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.41
3 0.42
4 0.43
5 0.47
6 0.47
7 0.48
8 0.53
9 0.55
10 0.59
11 0.63
12 0.64
13 0.66
14 0.71
15 0.73
16 0.73
17 0.78
18 0.79
19 0.8
20 0.81
21 0.82
22 0.8
23 0.8
24 0.79
25 0.81
26 0.8
27 0.8
28 0.73
29 0.68
30 0.66
31 0.64
32 0.56
33 0.49
34 0.42
35 0.34
36 0.3
37 0.25
38 0.21
39 0.14
40 0.18
41 0.17
42 0.19
43 0.19
44 0.2
45 0.22
46 0.21
47 0.22
48 0.17
49 0.15
50 0.14
51 0.15
52 0.14
53 0.13
54 0.1
55 0.13
56 0.13
57 0.14
58 0.13
59 0.12
60 0.11
61 0.1
62 0.11
63 0.07
64 0.07
65 0.06
66 0.07
67 0.08
68 0.09
69 0.1
70 0.11
71 0.13
72 0.17
73 0.18
74 0.18
75 0.22
76 0.22
77 0.23
78 0.23
79 0.21
80 0.17
81 0.19
82 0.18
83 0.13
84 0.13
85 0.11
86 0.09
87 0.09
88 0.09
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06