Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1D538

Protein Details
Accession A1D538   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-40DSASHQQKKAPGRKRGAKKPKTQSSAPHydrophilic
NLS Segment(s)
PositionSequence
21-34KKAPGRKRGAKKPK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
KEGG nfi:NFIA_022420  -  
Amino Acid Sequences MVSAKRKGLEGEDDSASHQQKKAPGRKRGAKKPKTQSSAPAQTTSAAADGSVLPQTHASVASSDQELQTPETPTPQPSKFWTNELRIALLVAVLKELDQTISEKTWHQVAETLRPVKPNISWNGARLEVGRLKREHFPNTTPAPSGQHNQLAQNSKDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.35
4 0.3
5 0.28
6 0.27
7 0.32
8 0.42
9 0.49
10 0.53
11 0.59
12 0.66
13 0.75
14 0.82
15 0.87
16 0.88
17 0.87
18 0.88
19 0.89
20 0.89
21 0.85
22 0.77
23 0.74
24 0.72
25 0.73
26 0.64
27 0.55
28 0.46
29 0.4
30 0.38
31 0.3
32 0.21
33 0.11
34 0.08
35 0.07
36 0.06
37 0.07
38 0.08
39 0.07
40 0.07
41 0.07
42 0.08
43 0.08
44 0.08
45 0.07
46 0.06
47 0.07
48 0.08
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.11
55 0.12
56 0.12
57 0.11
58 0.14
59 0.14
60 0.15
61 0.2
62 0.19
63 0.19
64 0.21
65 0.26
66 0.24
67 0.28
68 0.32
69 0.3
70 0.33
71 0.32
72 0.29
73 0.24
74 0.23
75 0.18
76 0.13
77 0.1
78 0.05
79 0.05
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.07
88 0.08
89 0.09
90 0.1
91 0.11
92 0.14
93 0.13
94 0.13
95 0.16
96 0.17
97 0.23
98 0.29
99 0.32
100 0.3
101 0.32
102 0.32
103 0.3
104 0.31
105 0.31
106 0.28
107 0.32
108 0.32
109 0.32
110 0.35
111 0.33
112 0.31
113 0.25
114 0.26
115 0.25
116 0.27
117 0.31
118 0.29
119 0.32
120 0.39
121 0.44
122 0.45
123 0.44
124 0.45
125 0.47
126 0.51
127 0.51
128 0.45
129 0.41
130 0.38
131 0.37
132 0.38
133 0.36
134 0.37
135 0.36
136 0.38
137 0.43
138 0.46
139 0.44