Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0K6R4

Protein Details
Accession A0A2X0K6R4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
102-125RTVQTEKAKKRQIHFPKRRFAVKAHydrophilic
NLS Segment(s)
PositionSequence
85-125LRAKKTRAIRRRLSLHERTVQTEKAKKRQIHFPKRRFAVKA
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSSKVRASELQSKKRDELLKQLDELKTELVSLRVQKITGGNASKLLRISTVRKSIARVLTVINQKTRSNLRELYKNKKQLPLDLRAKKTRAIRRRLSLHERTVQTEKAKKRQIHFPKRRFAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.63
4 0.55
5 0.56
6 0.55
7 0.52
8 0.49
9 0.53
10 0.46
11 0.41
12 0.39
13 0.3
14 0.21
15 0.18
16 0.16
17 0.12
18 0.13
19 0.14
20 0.17
21 0.17
22 0.17
23 0.18
24 0.19
25 0.19
26 0.22
27 0.21
28 0.18
29 0.22
30 0.23
31 0.22
32 0.21
33 0.19
34 0.16
35 0.17
36 0.2
37 0.21
38 0.26
39 0.27
40 0.28
41 0.3
42 0.33
43 0.33
44 0.3
45 0.24
46 0.2
47 0.24
48 0.28
49 0.27
50 0.25
51 0.25
52 0.24
53 0.27
54 0.3
55 0.26
56 0.25
57 0.29
58 0.3
59 0.37
60 0.42
61 0.48
62 0.52
63 0.59
64 0.57
65 0.59
66 0.57
67 0.56
68 0.57
69 0.57
70 0.59
71 0.58
72 0.61
73 0.6
74 0.6
75 0.57
76 0.61
77 0.61
78 0.6
79 0.61
80 0.63
81 0.66
82 0.73
83 0.76
84 0.76
85 0.74
86 0.72
87 0.71
88 0.65
89 0.62
90 0.58
91 0.54
92 0.52
93 0.53
94 0.54
95 0.56
96 0.63
97 0.63
98 0.64
99 0.7
100 0.74
101 0.77
102 0.8
103 0.8
104 0.81
105 0.83