Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0NGE1

Protein Details
Accession A0A2X0NGE1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-34GFKTKAPAKAKTKTTQKKLQNKDPKKGARTIHydrophilic
NLS Segment(s)
PositionSequence
8-38KAPAKAKTKTTQKKLQNKDPKKGARTIPPKR
Subcellular Location(s) mito 11, cyto 7, nucl 6, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010285  DNA_helicase_pif1-like  
IPR019034  UPF0390  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003678  F:DNA helicase activity  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
GO:0000723  P:telomere maintenance  
Pfam View protein in Pfam  
PF09495  DUF2462  
PF05970  PIF1  
Amino Acid Sequences MAQGFKTKAPAKAKTKTTQKKLQNKDPKKGARTIPPKRQSLVAQAIVHRKNTSSHHTSLEKTIATQAISHGKLTINGGRTESAQEVMRVELDARPEESRGWKRWDDEKGCMQTRLRHVCMCSLCKLLVAKQGNLAKLMRLCELVVWDEAPMQHRRCFEVANKHLQDVRSNLALFGGVTLALADRWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.79
4 0.8
5 0.8
6 0.82
7 0.84
8 0.86
9 0.88
10 0.88
11 0.86
12 0.87
13 0.88
14 0.86
15 0.81
16 0.79
17 0.74
18 0.73
19 0.75
20 0.75
21 0.76
22 0.75
23 0.73
24 0.67
25 0.65
26 0.58
27 0.55
28 0.52
29 0.47
30 0.41
31 0.41
32 0.48
33 0.46
34 0.45
35 0.37
36 0.31
37 0.28
38 0.31
39 0.34
40 0.32
41 0.32
42 0.36
43 0.38
44 0.39
45 0.38
46 0.36
47 0.28
48 0.23
49 0.23
50 0.18
51 0.16
52 0.15
53 0.14
54 0.17
55 0.17
56 0.17
57 0.16
58 0.15
59 0.15
60 0.17
61 0.18
62 0.14
63 0.14
64 0.15
65 0.15
66 0.15
67 0.16
68 0.14
69 0.12
70 0.1
71 0.1
72 0.1
73 0.09
74 0.09
75 0.07
76 0.07
77 0.07
78 0.08
79 0.08
80 0.09
81 0.09
82 0.1
83 0.11
84 0.17
85 0.21
86 0.24
87 0.28
88 0.29
89 0.32
90 0.37
91 0.45
92 0.41
93 0.41
94 0.45
95 0.46
96 0.45
97 0.45
98 0.4
99 0.38
100 0.42
101 0.45
102 0.4
103 0.36
104 0.35
105 0.38
106 0.41
107 0.38
108 0.32
109 0.27
110 0.24
111 0.24
112 0.25
113 0.21
114 0.25
115 0.25
116 0.23
117 0.28
118 0.31
119 0.29
120 0.31
121 0.29
122 0.23
123 0.22
124 0.24
125 0.18
126 0.16
127 0.15
128 0.14
129 0.15
130 0.14
131 0.12
132 0.11
133 0.1
134 0.1
135 0.11
136 0.15
137 0.19
138 0.21
139 0.24
140 0.26
141 0.29
142 0.3
143 0.33
144 0.36
145 0.41
146 0.44
147 0.5
148 0.5
149 0.49
150 0.51
151 0.48
152 0.46
153 0.38
154 0.37
155 0.31
156 0.29
157 0.27
158 0.24
159 0.22
160 0.18
161 0.14
162 0.1
163 0.05
164 0.05
165 0.05
166 0.05