Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0LD28

Protein Details
Accession A0A2X0LD28    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
12-36ESRTEVMRRKLRNRKGGPRWDSPRRBasic
NLS Segment(s)
PositionSequence
19-31RRKLRNRKGGPRW
Subcellular Location(s) mito 16, nucl 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MRRSPLLSGEVESRTEVMRRKLRNRKGGPRWDSPRRVTMYIPKSAAGEIAGAPKSPPQGGGLAGARMNPPALAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.22
4 0.27
5 0.33
6 0.4
7 0.5
8 0.59
9 0.67
10 0.75
11 0.79
12 0.81
13 0.84
14 0.86
15 0.82
16 0.81
17 0.8
18 0.78
19 0.75
20 0.67
21 0.64
22 0.57
23 0.52
24 0.44
25 0.44
26 0.4
27 0.38
28 0.35
29 0.29
30 0.26
31 0.24
32 0.23
33 0.15
34 0.11
35 0.07
36 0.1
37 0.1
38 0.09
39 0.1
40 0.11
41 0.13
42 0.12
43 0.12
44 0.11
45 0.12
46 0.12
47 0.16
48 0.16
49 0.16
50 0.16
51 0.17
52 0.16
53 0.15
54 0.15