Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0L919

Protein Details
Accession A0A2X0L919    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MRHKQKKKKTKSSTSLSLRDSHydrophilic
NLS Segment(s)
PositionSequence
4-9KQKKKK
Subcellular Location(s) nucl 23, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Amino Acid Sequences MRHKQKKKKTKSSTSLSLRDSDTHPESSSASTSSSSHHPGSTKTEAQKRFEQVQKKRLLEKAAKAATKTHKERVAEFNEKLENMSEHYDIPRGEVQVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.83
3 0.74
4 0.66
5 0.57
6 0.5
7 0.43
8 0.39
9 0.34
10 0.29
11 0.27
12 0.25
13 0.24
14 0.23
15 0.22
16 0.16
17 0.13
18 0.12
19 0.12
20 0.13
21 0.15
22 0.18
23 0.18
24 0.18
25 0.18
26 0.19
27 0.25
28 0.28
29 0.29
30 0.31
31 0.37
32 0.39
33 0.43
34 0.45
35 0.43
36 0.44
37 0.45
38 0.49
39 0.49
40 0.53
41 0.57
42 0.55
43 0.56
44 0.53
45 0.54
46 0.5
47 0.48
48 0.48
49 0.45
50 0.44
51 0.4
52 0.43
53 0.45
54 0.49
55 0.49
56 0.47
57 0.47
58 0.47
59 0.51
60 0.53
61 0.53
62 0.51
63 0.47
64 0.45
65 0.42
66 0.41
67 0.37
68 0.31
69 0.23
70 0.19
71 0.22
72 0.18
73 0.17
74 0.19
75 0.21
76 0.19
77 0.22
78 0.23