Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0KVN8

Protein Details
Accession A0A2X0KVN8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
103-132QDPPPWTTRWRTPPPPPRRSHQLEARCRPFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 5, plas 2
Family & Domain DBs
Amino Acid Sequences MKSAVKRHPTAVTTGEVIVPVRFGMIPSTHLGVFAEAIVNPQIPEEVGLIMPLIYSPLFQTSDERRSTPSPYGGIFRFARGSVALMFLASMIDHLSSQDQSSQDPPPWTTRWRTPPPPPRRSHQLEARCRPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.19
4 0.18
5 0.14
6 0.11
7 0.08
8 0.08
9 0.07
10 0.07
11 0.09
12 0.09
13 0.11
14 0.13
15 0.15
16 0.14
17 0.14
18 0.14
19 0.12
20 0.11
21 0.09
22 0.08
23 0.05
24 0.07
25 0.07
26 0.07
27 0.06
28 0.06
29 0.06
30 0.05
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.03
42 0.03
43 0.04
44 0.06
45 0.07
46 0.07
47 0.12
48 0.15
49 0.21
50 0.22
51 0.22
52 0.23
53 0.24
54 0.27
55 0.25
56 0.23
57 0.19
58 0.18
59 0.21
60 0.19
61 0.22
62 0.19
63 0.18
64 0.17
65 0.16
66 0.15
67 0.12
68 0.13
69 0.09
70 0.09
71 0.08
72 0.07
73 0.07
74 0.06
75 0.06
76 0.04
77 0.04
78 0.03
79 0.04
80 0.04
81 0.04
82 0.06
83 0.07
84 0.07
85 0.1
86 0.11
87 0.12
88 0.15
89 0.18
90 0.2
91 0.22
92 0.24
93 0.26
94 0.29
95 0.33
96 0.36
97 0.42
98 0.48
99 0.55
100 0.62
101 0.67
102 0.75
103 0.81
104 0.85
105 0.81
106 0.79
107 0.79
108 0.79
109 0.78
110 0.77
111 0.77
112 0.78