Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0L6H4

Protein Details
Accession A0A2X0L6H4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
214-251QVENDTRLKPKPKPKGKGKPKPKPKGGKSKHWKHKEAKBasic
NLS Segment(s)
PositionSequence
149-151RKL
221-251LKPKPKPKGKGKPKPKPKGGKSKHWKHKEAK
Subcellular Location(s) nucl 11.5, mito 8, cyto_nucl 7.5, plas 4, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSALHRRTVSSTRSSRSKENPPSINLNTFPFSSIPTNRFKPRHLMPSCFISILRRYIPILRGYIHHTKLTLPRVLCVCLILLYFILYLISHLITYGRSHHNKPLVCPPTTASMPLWERQQSHRRVIPIYETLDQSHRKKLEVRSMSRLRKLKERLSPLVAKKAPLDDGMEVEEVKQPARRVKEPKGKTGEEKAAHEHGLTNLQDVQLPKSVASQVENDTRLKPKPKPKGKGKPKPKPKGGKSKHWKHKEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.64
4 0.7
5 0.7
6 0.72
7 0.72
8 0.68
9 0.72
10 0.67
11 0.65
12 0.56
13 0.49
14 0.42
15 0.36
16 0.33
17 0.25
18 0.24
19 0.25
20 0.28
21 0.28
22 0.33
23 0.4
24 0.47
25 0.5
26 0.49
27 0.52
28 0.54
29 0.6
30 0.58
31 0.58
32 0.52
33 0.55
34 0.54
35 0.46
36 0.39
37 0.32
38 0.31
39 0.29
40 0.28
41 0.22
42 0.23
43 0.26
44 0.29
45 0.28
46 0.27
47 0.23
48 0.24
49 0.29
50 0.35
51 0.33
52 0.3
53 0.28
54 0.3
55 0.35
56 0.38
57 0.36
58 0.29
59 0.29
60 0.3
61 0.31
62 0.27
63 0.21
64 0.16
65 0.12
66 0.12
67 0.09
68 0.07
69 0.06
70 0.06
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.05
77 0.04
78 0.04
79 0.05
80 0.05
81 0.06
82 0.1
83 0.17
84 0.21
85 0.23
86 0.29
87 0.34
88 0.35
89 0.37
90 0.43
91 0.4
92 0.37
93 0.36
94 0.32
95 0.3
96 0.3
97 0.28
98 0.18
99 0.19
100 0.19
101 0.2
102 0.22
103 0.19
104 0.21
105 0.26
106 0.35
107 0.33
108 0.37
109 0.38
110 0.37
111 0.36
112 0.35
113 0.31
114 0.26
115 0.25
116 0.21
117 0.2
118 0.19
119 0.22
120 0.26
121 0.25
122 0.28
123 0.26
124 0.25
125 0.3
126 0.34
127 0.4
128 0.43
129 0.45
130 0.49
131 0.57
132 0.6
133 0.62
134 0.62
135 0.55
136 0.56
137 0.58
138 0.56
139 0.54
140 0.57
141 0.54
142 0.54
143 0.59
144 0.53
145 0.56
146 0.49
147 0.43
148 0.37
149 0.34
150 0.29
151 0.23
152 0.23
153 0.14
154 0.14
155 0.14
156 0.13
157 0.11
158 0.11
159 0.13
160 0.11
161 0.12
162 0.14
163 0.15
164 0.2
165 0.26
166 0.33
167 0.37
168 0.48
169 0.57
170 0.59
171 0.66
172 0.68
173 0.65
174 0.63
175 0.63
176 0.61
177 0.54
178 0.52
179 0.48
180 0.43
181 0.4
182 0.35
183 0.28
184 0.21
185 0.24
186 0.21
187 0.18
188 0.17
189 0.16
190 0.19
191 0.18
192 0.2
193 0.18
194 0.19
195 0.17
196 0.18
197 0.2
198 0.19
199 0.2
200 0.2
201 0.21
202 0.27
203 0.29
204 0.28
205 0.3
206 0.33
207 0.38
208 0.43
209 0.47
210 0.51
211 0.6
212 0.69
213 0.75
214 0.82
215 0.86
216 0.91
217 0.93
218 0.94
219 0.94
220 0.95
221 0.96
222 0.95
223 0.95
224 0.93
225 0.94
226 0.91
227 0.91
228 0.91
229 0.91
230 0.92
231 0.91