Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0KMU7

Protein Details
Accession A0A2X0KMU7    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTVCTHCKARHRECERTKSTGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 7, mito 6, cyto 3, plas 3, pero 3, golg 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025476  Helitron_helicase-like  
Pfam View protein in Pfam  
PF14214  Helitron_like_N  
Amino Acid Sequences MTVCTHCKARHRECERTKSTGHFSTCCSQGKVQLPPSLRPNPDFQQLLEGSDSGIPAFRENARSYNNALSFTSLAAHFDQTRPGTQGPRMFCVFAFAHIWLIDPAEATDTRLGPDGADSRIQRSTLTKLDSMLGTGHRFVREFASAKARAGWGRGPQDLILQAHGDQCPDGRPKYQVVSLLHPSAMPLHSPLLFPAGEDDCLPNIPLCSSNQAGSPFADEEDEDEEEGDEENGDGEPQIKGVEVASLAFTILCVLLAQTRRVLLNPALHPTCLPGVRDDGYSHVETDRLNLPPVASRKPPPHHGPRYHQLDPGQIGSLPMACVVKYGKPSLFITVTCNPDWPKIKAALGPNDQACNRPDLIARVFEAKLNRLCDDIFGNKQRAGCLGDEWRTVSLLYFIVCFLSLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.84
3 0.79
4 0.73
5 0.69
6 0.69
7 0.66
8 0.6
9 0.52
10 0.51
11 0.51
12 0.53
13 0.51
14 0.47
15 0.41
16 0.44
17 0.48
18 0.51
19 0.52
20 0.51
21 0.5
22 0.52
23 0.58
24 0.59
25 0.56
26 0.5
27 0.51
28 0.49
29 0.53
30 0.49
31 0.41
32 0.41
33 0.38
34 0.37
35 0.31
36 0.26
37 0.2
38 0.19
39 0.19
40 0.1
41 0.12
42 0.1
43 0.1
44 0.13
45 0.14
46 0.19
47 0.21
48 0.26
49 0.28
50 0.3
51 0.33
52 0.38
53 0.37
54 0.34
55 0.32
56 0.29
57 0.26
58 0.24
59 0.22
60 0.14
61 0.14
62 0.13
63 0.15
64 0.14
65 0.15
66 0.2
67 0.2
68 0.21
69 0.23
70 0.24
71 0.26
72 0.3
73 0.35
74 0.32
75 0.35
76 0.35
77 0.32
78 0.29
79 0.3
80 0.26
81 0.22
82 0.2
83 0.16
84 0.16
85 0.15
86 0.16
87 0.11
88 0.11
89 0.09
90 0.08
91 0.07
92 0.09
93 0.09
94 0.09
95 0.12
96 0.11
97 0.12
98 0.13
99 0.13
100 0.1
101 0.13
102 0.13
103 0.13
104 0.17
105 0.17
106 0.19
107 0.2
108 0.21
109 0.19
110 0.2
111 0.23
112 0.23
113 0.26
114 0.24
115 0.23
116 0.24
117 0.23
118 0.21
119 0.18
120 0.15
121 0.13
122 0.14
123 0.15
124 0.15
125 0.15
126 0.15
127 0.16
128 0.18
129 0.18
130 0.19
131 0.25
132 0.24
133 0.24
134 0.25
135 0.24
136 0.21
137 0.22
138 0.22
139 0.2
140 0.23
141 0.23
142 0.22
143 0.21
144 0.22
145 0.22
146 0.19
147 0.14
148 0.11
149 0.11
150 0.13
151 0.13
152 0.12
153 0.09
154 0.09
155 0.12
156 0.15
157 0.15
158 0.15
159 0.17
160 0.19
161 0.21
162 0.23
163 0.25
164 0.24
165 0.27
166 0.28
167 0.27
168 0.25
169 0.22
170 0.2
171 0.16
172 0.14
173 0.09
174 0.08
175 0.08
176 0.09
177 0.09
178 0.09
179 0.09
180 0.09
181 0.08
182 0.1
183 0.09
184 0.09
185 0.09
186 0.1
187 0.08
188 0.08
189 0.08
190 0.06
191 0.05
192 0.06
193 0.06
194 0.06
195 0.09
196 0.1
197 0.1
198 0.12
199 0.13
200 0.13
201 0.13
202 0.13
203 0.11
204 0.1
205 0.1
206 0.07
207 0.07
208 0.09
209 0.09
210 0.07
211 0.07
212 0.07
213 0.07
214 0.07
215 0.06
216 0.04
217 0.03
218 0.04
219 0.04
220 0.04
221 0.03
222 0.04
223 0.04
224 0.04
225 0.05
226 0.04
227 0.04
228 0.04
229 0.05
230 0.04
231 0.05
232 0.05
233 0.05
234 0.05
235 0.04
236 0.04
237 0.04
238 0.04
239 0.03
240 0.03
241 0.03
242 0.07
243 0.08
244 0.09
245 0.1
246 0.11
247 0.11
248 0.12
249 0.15
250 0.15
251 0.2
252 0.21
253 0.26
254 0.26
255 0.26
256 0.25
257 0.24
258 0.24
259 0.19
260 0.18
261 0.13
262 0.16
263 0.17
264 0.18
265 0.17
266 0.17
267 0.19
268 0.19
269 0.18
270 0.15
271 0.15
272 0.14
273 0.17
274 0.18
275 0.15
276 0.15
277 0.15
278 0.15
279 0.2
280 0.24
281 0.26
282 0.26
283 0.3
284 0.38
285 0.43
286 0.51
287 0.54
288 0.61
289 0.66
290 0.71
291 0.74
292 0.74
293 0.77
294 0.72
295 0.67
296 0.58
297 0.53
298 0.47
299 0.4
300 0.32
301 0.23
302 0.21
303 0.17
304 0.16
305 0.11
306 0.1
307 0.09
308 0.07
309 0.09
310 0.1
311 0.14
312 0.16
313 0.2
314 0.2
315 0.23
316 0.25
317 0.28
318 0.28
319 0.25
320 0.28
321 0.31
322 0.34
323 0.3
324 0.33
325 0.3
326 0.36
327 0.4
328 0.37
329 0.35
330 0.35
331 0.37
332 0.38
333 0.43
334 0.45
335 0.44
336 0.47
337 0.45
338 0.46
339 0.44
340 0.42
341 0.36
342 0.32
343 0.28
344 0.24
345 0.24
346 0.25
347 0.27
348 0.27
349 0.27
350 0.27
351 0.27
352 0.28
353 0.29
354 0.3
355 0.33
356 0.34
357 0.33
358 0.3
359 0.3
360 0.29
361 0.3
362 0.3
363 0.33
364 0.36
365 0.39
366 0.4
367 0.41
368 0.4
369 0.38
370 0.35
371 0.28
372 0.26
373 0.3
374 0.32
375 0.33
376 0.33
377 0.31
378 0.29
379 0.28
380 0.23
381 0.17
382 0.14
383 0.13
384 0.11
385 0.1
386 0.1