Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0LRQ3

Protein Details
Accession A0A2X0LRQ3    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-62ASKFVFRTKRDKDGRPTSYKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, cyto 10.5, nucl 8.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR013103  RVT_2  
Pfam View protein in Pfam  
PF07727  RVT_2  
Amino Acid Sequences MAHHKSHEWAQGAIDEFESLRDDYSVFTITKRDELPAGAKVLASKFVFRTKRDKDGRPTSYKARLVARGFTQRPGIDFKETFAPTAKFVSIRTLIALAAARGYHIIQADIDKAYLHGELEEELYMRVPEGIRLPDNVCLKLHRSIYGLKQAGRVWNETIHKTLVKLGYNRLRSEECVYRRTLGKDDYYIAVYVDDLLFVGPDLSEIDRVLDELDRLYGVKRLGNAEYILGVQLIRQADGIALSQRQYLLDVLARFGMADANKSVLPMQPGLQLKPCDTPDPSFQTQYRSAIGSLMYAVVATRPDLAYPVSYLARFTNKAGSDHWAAVLQILRYIKGTLELGIVYKAKRDSLVGYVGYSDSDWGSSDGAGGIRRCQHDPNGRSVIDSRTSAGDASDDTRRVSSFPPLEVNAVDAFSMGSVSSSDLIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.18
3 0.16
4 0.16
5 0.17
6 0.13
7 0.11
8 0.11
9 0.11
10 0.11
11 0.13
12 0.15
13 0.13
14 0.14
15 0.18
16 0.19
17 0.24
18 0.24
19 0.24
20 0.22
21 0.25
22 0.28
23 0.27
24 0.28
25 0.23
26 0.22
27 0.23
28 0.22
29 0.25
30 0.22
31 0.22
32 0.23
33 0.31
34 0.37
35 0.38
36 0.48
37 0.48
38 0.58
39 0.64
40 0.69
41 0.7
42 0.76
43 0.81
44 0.78
45 0.77
46 0.75
47 0.75
48 0.7
49 0.65
50 0.6
51 0.59
52 0.54
53 0.53
54 0.51
55 0.52
56 0.5
57 0.48
58 0.47
59 0.4
60 0.39
61 0.4
62 0.37
63 0.34
64 0.32
65 0.31
66 0.34
67 0.34
68 0.33
69 0.31
70 0.29
71 0.24
72 0.26
73 0.26
74 0.18
75 0.18
76 0.23
77 0.21
78 0.2
79 0.19
80 0.17
81 0.16
82 0.17
83 0.16
84 0.1
85 0.09
86 0.08
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.09
93 0.08
94 0.1
95 0.11
96 0.11
97 0.11
98 0.09
99 0.09
100 0.09
101 0.09
102 0.08
103 0.06
104 0.06
105 0.07
106 0.08
107 0.08
108 0.07
109 0.07
110 0.07
111 0.07
112 0.06
113 0.07
114 0.06
115 0.08
116 0.1
117 0.13
118 0.14
119 0.16
120 0.17
121 0.21
122 0.24
123 0.24
124 0.21
125 0.21
126 0.23
127 0.26
128 0.26
129 0.22
130 0.22
131 0.25
132 0.28
133 0.35
134 0.35
135 0.31
136 0.33
137 0.33
138 0.36
139 0.34
140 0.32
141 0.24
142 0.27
143 0.29
144 0.27
145 0.27
146 0.24
147 0.22
148 0.2
149 0.23
150 0.22
151 0.23
152 0.23
153 0.28
154 0.34
155 0.37
156 0.37
157 0.36
158 0.33
159 0.32
160 0.35
161 0.35
162 0.31
163 0.3
164 0.31
165 0.3
166 0.32
167 0.32
168 0.31
169 0.26
170 0.24
171 0.23
172 0.23
173 0.22
174 0.2
175 0.17
176 0.14
177 0.11
178 0.09
179 0.08
180 0.06
181 0.05
182 0.04
183 0.03
184 0.03
185 0.03
186 0.03
187 0.02
188 0.03
189 0.03
190 0.04
191 0.04
192 0.04
193 0.05
194 0.05
195 0.05
196 0.06
197 0.05
198 0.05
199 0.05
200 0.05
201 0.04
202 0.05
203 0.05
204 0.07
205 0.08
206 0.09
207 0.1
208 0.12
209 0.12
210 0.13
211 0.13
212 0.11
213 0.1
214 0.09
215 0.08
216 0.06
217 0.05
218 0.04
219 0.07
220 0.07
221 0.06
222 0.06
223 0.06
224 0.06
225 0.07
226 0.07
227 0.06
228 0.06
229 0.07
230 0.07
231 0.07
232 0.07
233 0.08
234 0.07
235 0.07
236 0.09
237 0.09
238 0.09
239 0.09
240 0.09
241 0.08
242 0.08
243 0.09
244 0.06
245 0.07
246 0.07
247 0.09
248 0.09
249 0.09
250 0.1
251 0.09
252 0.11
253 0.1
254 0.11
255 0.15
256 0.17
257 0.18
258 0.22
259 0.22
260 0.22
261 0.26
262 0.26
263 0.23
264 0.24
265 0.25
266 0.26
267 0.33
268 0.34
269 0.33
270 0.33
271 0.35
272 0.36
273 0.35
274 0.31
275 0.24
276 0.22
277 0.19
278 0.18
279 0.13
280 0.11
281 0.09
282 0.07
283 0.05
284 0.05
285 0.05
286 0.05
287 0.05
288 0.06
289 0.06
290 0.06
291 0.07
292 0.08
293 0.08
294 0.09
295 0.11
296 0.11
297 0.11
298 0.12
299 0.14
300 0.18
301 0.18
302 0.19
303 0.23
304 0.24
305 0.25
306 0.26
307 0.28
308 0.27
309 0.26
310 0.25
311 0.19
312 0.17
313 0.17
314 0.18
315 0.13
316 0.14
317 0.14
318 0.13
319 0.14
320 0.14
321 0.12
322 0.12
323 0.13
324 0.1
325 0.11
326 0.11
327 0.11
328 0.13
329 0.15
330 0.12
331 0.16
332 0.16
333 0.16
334 0.16
335 0.17
336 0.17
337 0.19
338 0.24
339 0.2
340 0.19
341 0.2
342 0.19
343 0.18
344 0.15
345 0.12
346 0.08
347 0.08
348 0.08
349 0.08
350 0.08
351 0.08
352 0.08
353 0.09
354 0.1
355 0.13
356 0.13
357 0.16
358 0.22
359 0.25
360 0.27
361 0.3
362 0.38
363 0.45
364 0.48
365 0.52
366 0.54
367 0.5
368 0.5
369 0.49
370 0.45
371 0.39
372 0.37
373 0.29
374 0.25
375 0.25
376 0.23
377 0.2
378 0.16
379 0.14
380 0.16
381 0.2
382 0.19
383 0.19
384 0.21
385 0.21
386 0.22
387 0.23
388 0.29
389 0.27
390 0.29
391 0.33
392 0.33
393 0.34
394 0.32
395 0.32
396 0.24
397 0.21
398 0.17
399 0.12
400 0.1
401 0.08
402 0.08
403 0.06
404 0.05
405 0.05
406 0.07