Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0NBV1

Protein Details
Accession A0A2X0NBV1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
88-108TTYSGMKKLRRRRVSVRALLGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, nucl 5, mito 5, mito_nucl 5
Family & Domain DBs
Amino Acid Sequences MSLCLSFLLFHTALAIAAPVPLRQARDVDPSHNELEQPNNTPSVDPKSAIPSLSSSASDDAKNSQAKQDGSKSRKNESMGTNSWSGGTTYSGMKKLRRRRVSVRALLGVKPPDSLTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.05
4 0.06
5 0.07
6 0.06
7 0.09
8 0.1
9 0.12
10 0.14
11 0.16
12 0.18
13 0.25
14 0.26
15 0.28
16 0.3
17 0.32
18 0.32
19 0.3
20 0.28
21 0.22
22 0.25
23 0.24
24 0.23
25 0.21
26 0.2
27 0.2
28 0.2
29 0.21
30 0.22
31 0.21
32 0.18
33 0.17
34 0.21
35 0.21
36 0.21
37 0.19
38 0.14
39 0.15
40 0.15
41 0.14
42 0.11
43 0.11
44 0.12
45 0.12
46 0.11
47 0.1
48 0.14
49 0.15
50 0.15
51 0.16
52 0.19
53 0.2
54 0.22
55 0.29
56 0.34
57 0.38
58 0.44
59 0.45
60 0.45
61 0.49
62 0.49
63 0.46
64 0.41
65 0.43
66 0.39
67 0.39
68 0.36
69 0.31
70 0.29
71 0.24
72 0.2
73 0.13
74 0.12
75 0.1
76 0.12
77 0.15
78 0.19
79 0.22
80 0.29
81 0.38
82 0.47
83 0.56
84 0.62
85 0.67
86 0.72
87 0.8
88 0.83
89 0.83
90 0.79
91 0.75
92 0.69
93 0.64
94 0.6
95 0.53
96 0.43
97 0.36