Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0L7F1

Protein Details
Accession A0A2X0L7F1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-97LVLPRRLRTRSRKKKDGHESCSBasic
NLS Segment(s)
PositionSequence
80-90RRLRTRSRKKK
Subcellular Location(s) nucl 20, cyto_nucl 13.333, cyto 4.5, cyto_mito 3.666
Family & Domain DBs
Amino Acid Sequences MNRAVREKGPSVQKEFDSCSDTKSDSFNASIAHFELPFASTIVLPSPPGPATNKVDSYQEIPNTRYKHQTARVAGLVLPRRLRTRSRKKKDGHESCSADHMTTSYDLGLISIGIGIDRHPSLHFFHGHPRYLDIPSIFNLGLIPPFRMCSDGYERNTTVLKKGGSRLVGSSDWPRRIRDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.47
4 0.42
5 0.36
6 0.32
7 0.3
8 0.3
9 0.27
10 0.25
11 0.24
12 0.21
13 0.22
14 0.21
15 0.19
16 0.18
17 0.18
18 0.16
19 0.15
20 0.13
21 0.12
22 0.11
23 0.1
24 0.1
25 0.09
26 0.08
27 0.07
28 0.07
29 0.09
30 0.08
31 0.08
32 0.08
33 0.1
34 0.1
35 0.12
36 0.14
37 0.18
38 0.23
39 0.26
40 0.28
41 0.27
42 0.28
43 0.28
44 0.29
45 0.27
46 0.27
47 0.25
48 0.25
49 0.3
50 0.32
51 0.33
52 0.35
53 0.34
54 0.37
55 0.41
56 0.46
57 0.43
58 0.43
59 0.41
60 0.36
61 0.34
62 0.32
63 0.29
64 0.24
65 0.24
66 0.22
67 0.23
68 0.26
69 0.32
70 0.38
71 0.46
72 0.55
73 0.62
74 0.7
75 0.73
76 0.8
77 0.84
78 0.83
79 0.77
80 0.75
81 0.68
82 0.59
83 0.58
84 0.48
85 0.36
86 0.26
87 0.21
88 0.13
89 0.1
90 0.1
91 0.06
92 0.06
93 0.05
94 0.05
95 0.05
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.05
104 0.05
105 0.06
106 0.07
107 0.09
108 0.11
109 0.15
110 0.17
111 0.17
112 0.26
113 0.31
114 0.33
115 0.32
116 0.32
117 0.31
118 0.3
119 0.32
120 0.23
121 0.2
122 0.18
123 0.2
124 0.17
125 0.14
126 0.13
127 0.11
128 0.13
129 0.12
130 0.12
131 0.1
132 0.12
133 0.12
134 0.14
135 0.14
136 0.17
137 0.24
138 0.31
139 0.35
140 0.4
141 0.4
142 0.41
143 0.44
144 0.39
145 0.34
146 0.32
147 0.3
148 0.27
149 0.32
150 0.35
151 0.34
152 0.34
153 0.33
154 0.32
155 0.31
156 0.31
157 0.36
158 0.38
159 0.44
160 0.45
161 0.45