Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LBB0

Protein Details
Accession E2LBB0   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
55-85TTTTRKPRATKGKSKARRKVRGRGKPKPSAIBasic
NLS Segment(s)
PositionSequence
59-82RKPRATKGKSKARRKVRGRGKPKP
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
KEGG mpr:MPER_03426  -  
Amino Acid Sequences MGNSAAPLRASASANSSRSNSPVVADSIVAEPEEVDDEENGEDVQDNGPKTTTTTTTTRKPRATKGKSKARRKVRGRGKPKPSAIAIPDPAEDIAATAVKDANKSVEDVDVDVEVDEVVVSADAERSEEEAEAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.3
4 0.28
5 0.28
6 0.3
7 0.24
8 0.19
9 0.2
10 0.19
11 0.17
12 0.15
13 0.15
14 0.13
15 0.13
16 0.12
17 0.09
18 0.07
19 0.07
20 0.08
21 0.07
22 0.07
23 0.06
24 0.07
25 0.07
26 0.08
27 0.07
28 0.05
29 0.05
30 0.05
31 0.07
32 0.08
33 0.09
34 0.09
35 0.1
36 0.09
37 0.11
38 0.12
39 0.13
40 0.14
41 0.19
42 0.23
43 0.31
44 0.39
45 0.44
46 0.48
47 0.5
48 0.55
49 0.6
50 0.64
51 0.66
52 0.68
53 0.73
54 0.77
55 0.83
56 0.84
57 0.83
58 0.85
59 0.82
60 0.83
61 0.83
62 0.83
63 0.83
64 0.84
65 0.82
66 0.8
67 0.76
68 0.7
69 0.61
70 0.55
71 0.48
72 0.44
73 0.37
74 0.29
75 0.27
76 0.23
77 0.21
78 0.17
79 0.13
80 0.08
81 0.07
82 0.06
83 0.06
84 0.05
85 0.08
86 0.08
87 0.09
88 0.09
89 0.11
90 0.11
91 0.12
92 0.12
93 0.12
94 0.12
95 0.12
96 0.13
97 0.11
98 0.1
99 0.09
100 0.09
101 0.06
102 0.05
103 0.05
104 0.04
105 0.04
106 0.03
107 0.04
108 0.04
109 0.05
110 0.05
111 0.06
112 0.07
113 0.09
114 0.1