Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0NAL3

Protein Details
Accession A0A2X0NAL3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-73AAQIQSLKRRRRRLGTRARSRLVGHydrophilic
NLS Segment(s)
PositionSequence
57-69KRRRRRLGTRARS
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MPRHGGIKTSQPGRHQNLVQITCLEVVENPDHEISFASLVKGCLQADKEAAQIQSLKRRRRRLGTRARSRLVGNRWVVDDCTRAGPEDVRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.56
3 0.54
4 0.55
5 0.52
6 0.47
7 0.38
8 0.32
9 0.26
10 0.24
11 0.18
12 0.1
13 0.11
14 0.11
15 0.11
16 0.12
17 0.11
18 0.11
19 0.11
20 0.11
21 0.08
22 0.09
23 0.08
24 0.07
25 0.08
26 0.09
27 0.09
28 0.1
29 0.1
30 0.1
31 0.1
32 0.1
33 0.11
34 0.11
35 0.11
36 0.11
37 0.11
38 0.11
39 0.13
40 0.14
41 0.22
42 0.29
43 0.37
44 0.43
45 0.53
46 0.59
47 0.67
48 0.75
49 0.76
50 0.8
51 0.83
52 0.86
53 0.85
54 0.81
55 0.73
56 0.66
57 0.64
58 0.58
59 0.55
60 0.47
61 0.4
62 0.4
63 0.38
64 0.37
65 0.32
66 0.28
67 0.22
68 0.23
69 0.21
70 0.21
71 0.21