Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0LZI6

Protein Details
Accession A0A2X0LZI6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-34LACARCKTRKTRCDGEKPACGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MRSPTGAAPLAKGLACARCKTRKTRCDGEKPACGACLRSARFKHRPLDQVVCHYSDPLDDTKPSISRAFIHSQLVLVSCRHRWRGSPIGAPGMRIGGGRVMESARAAAHRCRTFLLKFALAGPGIGGVLLMCAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.26
4 0.32
5 0.39
6 0.44
7 0.53
8 0.61
9 0.62
10 0.68
11 0.75
12 0.77
13 0.79
14 0.83
15 0.8
16 0.77
17 0.71
18 0.64
19 0.55
20 0.46
21 0.36
22 0.31
23 0.32
24 0.27
25 0.32
26 0.36
27 0.43
28 0.5
29 0.55
30 0.55
31 0.54
32 0.58
33 0.56
34 0.59
35 0.52
36 0.51
37 0.47
38 0.43
39 0.36
40 0.31
41 0.25
42 0.17
43 0.17
44 0.12
45 0.12
46 0.09
47 0.1
48 0.12
49 0.13
50 0.15
51 0.13
52 0.13
53 0.13
54 0.17
55 0.19
56 0.18
57 0.18
58 0.16
59 0.16
60 0.15
61 0.15
62 0.12
63 0.1
64 0.1
65 0.12
66 0.16
67 0.19
68 0.2
69 0.21
70 0.27
71 0.35
72 0.37
73 0.39
74 0.37
75 0.42
76 0.41
77 0.4
78 0.33
79 0.25
80 0.21
81 0.16
82 0.14
83 0.09
84 0.09
85 0.08
86 0.09
87 0.09
88 0.09
89 0.09
90 0.09
91 0.08
92 0.09
93 0.12
94 0.16
95 0.24
96 0.26
97 0.27
98 0.29
99 0.33
100 0.33
101 0.36
102 0.37
103 0.3
104 0.29
105 0.29
106 0.3
107 0.25
108 0.23
109 0.17
110 0.12
111 0.09
112 0.08
113 0.07
114 0.04