Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0KCU9

Protein Details
Accession A0A2X0KCU9    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
53-77LALYRNTRRRMIRKKRTQNRLFGWQHydrophilic
NLS Segment(s)
PositionSequence
38-68RRNSGQRLARGKPGGLALYRNTRRRMIRKKR
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MPPIAGFSGESQSSDVATYTGCFRSGQRGGGYASVFRRRNSGQRLARGKPGGLALYRNTRRRMIRKKRTQNRLFGWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.07
4 0.07
5 0.07
6 0.09
7 0.1
8 0.1
9 0.1
10 0.11
11 0.19
12 0.2
13 0.23
14 0.21
15 0.22
16 0.22
17 0.23
18 0.23
19 0.18
20 0.19
21 0.25
22 0.26
23 0.24
24 0.27
25 0.27
26 0.33
27 0.37
28 0.43
29 0.4
30 0.48
31 0.54
32 0.52
33 0.56
34 0.51
35 0.45
36 0.36
37 0.33
38 0.26
39 0.2
40 0.2
41 0.18
42 0.27
43 0.34
44 0.38
45 0.39
46 0.44
47 0.52
48 0.6
49 0.68
50 0.69
51 0.74
52 0.8
53 0.88
54 0.92
55 0.94
56 0.92
57 0.91