Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0LA88

Protein Details
Accession A0A2X0LA88   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSPPPSHRPHRHRHHRLRAPLLHDBasic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 11.5, extr 4
Family & Domain DBs
Amino Acid Sequences MSPPPSHRPHRHRHHRLRAPLLHDIANCIIVKTPPGSSPEPVFAALGKQFPAAPGGAMPVVIKGQRGLRFQRGRPAPACRYASYRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.92
4 0.91
5 0.85
6 0.79
7 0.75
8 0.66
9 0.57
10 0.47
11 0.4
12 0.31
13 0.28
14 0.22
15 0.15
16 0.14
17 0.11
18 0.12
19 0.11
20 0.11
21 0.1
22 0.15
23 0.16
24 0.17
25 0.18
26 0.19
27 0.19
28 0.18
29 0.16
30 0.12
31 0.11
32 0.11
33 0.1
34 0.08
35 0.08
36 0.07
37 0.07
38 0.09
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.05
47 0.07
48 0.07
49 0.07
50 0.08
51 0.14
52 0.2
53 0.25
54 0.3
55 0.39
56 0.46
57 0.48
58 0.57
59 0.57
60 0.58
61 0.58
62 0.61
63 0.57
64 0.58
65 0.6
66 0.53