Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0LF33

Protein Details
Accession A0A2X0LF33    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-98LAPVRMTARTRRKPPKAMCGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, plas 7, mito 3, cyto 1, pero 1, E.R. 1, golg 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MSTPAANLGDFLRVLMAVQAVILTLQVSLSDVVKQQIVDAYKTDAFCQEALNNIASVTSEFKIIDALLYLRGRLVIPLLAPVRMTARTRRKPPKAMCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.04
10 0.03
11 0.03
12 0.03
13 0.03
14 0.04
15 0.05
16 0.05
17 0.06
18 0.07
19 0.08
20 0.09
21 0.09
22 0.08
23 0.11
24 0.11
25 0.11
26 0.11
27 0.13
28 0.15
29 0.15
30 0.15
31 0.13
32 0.13
33 0.12
34 0.12
35 0.09
36 0.09
37 0.1
38 0.1
39 0.09
40 0.08
41 0.08
42 0.07
43 0.08
44 0.08
45 0.07
46 0.07
47 0.07
48 0.07
49 0.08
50 0.08
51 0.07
52 0.05
53 0.06
54 0.09
55 0.1
56 0.1
57 0.09
58 0.1
59 0.1
60 0.1
61 0.1
62 0.07
63 0.07
64 0.12
65 0.13
66 0.13
67 0.13
68 0.14
69 0.15
70 0.18
71 0.21
72 0.26
73 0.36
74 0.46
75 0.56
76 0.67
77 0.73
78 0.8