Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0NGY4

Protein Details
Accession A0A2X0NGY4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-29LQLPNQNQNQKQNQKQNQKQNQNQNQIQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
Amino Acid Sequences MLQLPNQNQNQKQNQKQNQKQNQNQNQIQCLGLLAPFPTARSSKYSRQECGQKRPGRYPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.85
4 0.87
5 0.87
6 0.88
7 0.86
8 0.87
9 0.86
10 0.84
11 0.79
12 0.71
13 0.62
14 0.53
15 0.44
16 0.33
17 0.23
18 0.14
19 0.1
20 0.07
21 0.06
22 0.06
23 0.06
24 0.07
25 0.09
26 0.1
27 0.11
28 0.17
29 0.22
30 0.3
31 0.4
32 0.45
33 0.46
34 0.53
35 0.62
36 0.65
37 0.7
38 0.71
39 0.69
40 0.7