Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0KCW9

Protein Details
Accession A0A2X0KCW9   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
53-76SETNSKRGGRRRRARVQPMHRYGAHydrophilic
NLS Segment(s)
PositionSequence
58-67KRGGRRRRAR
Subcellular Location(s) mito 9.5, cyto_mito 7.5, nucl 7, pero 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024491  Se_SelK/SelG  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10961  SelK_SelG  
Amino Acid Sequences MAPSYIDSKGNLHDKAPWHHQVLVFMQEAWLALWLFFSTLINGARCETRGDESETNSKRGGRRRRARVQPMHRYGAALQEATVAEEEEEEDQHLREELGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.44
4 0.43
5 0.4
6 0.42
7 0.42
8 0.41
9 0.38
10 0.35
11 0.28
12 0.22
13 0.19
14 0.16
15 0.15
16 0.11
17 0.1
18 0.06
19 0.05
20 0.06
21 0.05
22 0.05
23 0.06
24 0.06
25 0.04
26 0.07
27 0.08
28 0.09
29 0.09
30 0.1
31 0.1
32 0.11
33 0.11
34 0.1
35 0.11
36 0.12
37 0.17
38 0.17
39 0.19
40 0.27
41 0.28
42 0.28
43 0.27
44 0.28
45 0.28
46 0.36
47 0.44
48 0.46
49 0.55
50 0.63
51 0.72
52 0.8
53 0.86
54 0.87
55 0.87
56 0.87
57 0.84
58 0.78
59 0.68
60 0.6
61 0.5
62 0.45
63 0.37
64 0.26
65 0.19
66 0.17
67 0.17
68 0.16
69 0.15
70 0.09
71 0.07
72 0.07
73 0.08
74 0.07
75 0.08
76 0.09
77 0.09
78 0.09
79 0.1
80 0.11