Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6U7X7

Protein Details
Accession Q6U7X7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
77-107AFPAAVKIRERKRKEKLKKQRFPPPVPAPSLHydrophilic
NLS Segment(s)
PositionSequence
82-103VKIRERKRKEKLKKQRFPPPVP
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Gene Ontology GO:0005739  C:mitochondrion  
Amino Acid Sequences MLDLLGAFLLLTASKKWSLPSLPFSLLLSYPHCGCLLRMQKLKKQGKRFLFLLSLAPQPECGAMEGKKQKKQILFLAFPAAVKIRERKRKEKLKKQRFPPPVPAPSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.18
5 0.22
6 0.25
7 0.3
8 0.32
9 0.32
10 0.33
11 0.32
12 0.29
13 0.25
14 0.23
15 0.19
16 0.16
17 0.14
18 0.14
19 0.14
20 0.13
21 0.13
22 0.2
23 0.25
24 0.31
25 0.36
26 0.39
27 0.43
28 0.54
29 0.62
30 0.61
31 0.63
32 0.64
33 0.64
34 0.65
35 0.62
36 0.54
37 0.46
38 0.4
39 0.33
40 0.26
41 0.21
42 0.17
43 0.15
44 0.12
45 0.11
46 0.1
47 0.08
48 0.07
49 0.08
50 0.08
51 0.16
52 0.25
53 0.3
54 0.35
55 0.38
56 0.42
57 0.43
58 0.47
59 0.47
60 0.47
61 0.43
62 0.39
63 0.4
64 0.36
65 0.32
66 0.29
67 0.22
68 0.16
69 0.17
70 0.24
71 0.29
72 0.39
73 0.47
74 0.56
75 0.65
76 0.75
77 0.84
78 0.87
79 0.89
80 0.9
81 0.92
82 0.92
83 0.92
84 0.92
85 0.88
86 0.87
87 0.86
88 0.81