Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6U7T6

Protein Details
Accession Q6U7T6   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
35-63FFRSADKRKEKHARKKKQGKESKRCFPFLBasic
NLS Segment(s)
PositionSequence
41-58KRKEKHARKKKQGKESKR
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
Amino Acid Sequences MPPSVSCCFLSLPSGFTAHPSTASQPEGGVLSCFFFRSADKRKEKHARKKKQGKESKRCFPFLRIRSSKVKKLNTFILATFECSWLANSFFFLIIIKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.18
4 0.2
5 0.16
6 0.17
7 0.17
8 0.18
9 0.19
10 0.21
11 0.18
12 0.15
13 0.15
14 0.14
15 0.13
16 0.1
17 0.08
18 0.07
19 0.07
20 0.08
21 0.07
22 0.07
23 0.08
24 0.16
25 0.24
26 0.33
27 0.41
28 0.42
29 0.52
30 0.62
31 0.71
32 0.74
33 0.77
34 0.78
35 0.81
36 0.9
37 0.89
38 0.89
39 0.89
40 0.89
41 0.89
42 0.87
43 0.86
44 0.8
45 0.77
46 0.68
47 0.65
48 0.64
49 0.58
50 0.59
51 0.54
52 0.54
53 0.6
54 0.64
55 0.65
56 0.64
57 0.67
58 0.62
59 0.63
60 0.65
61 0.58
62 0.54
63 0.47
64 0.43
65 0.35
66 0.34
67 0.3
68 0.23
69 0.2
70 0.18
71 0.19
72 0.15
73 0.16
74 0.12
75 0.13
76 0.13
77 0.12
78 0.12