Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0KS05

Protein Details
Accession A0A2X0KS05    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
50-75SPEVWHFRNTRRRMIRKKRTQNRLFGHydrophilic
NLS Segment(s)
PositionSequence
60-68RRRMIRKKR
Subcellular Location(s) nucl 15, mito 6, cyto 2, cysk 2
Family & Domain DBs
Amino Acid Sequences MPPIAEFSGESQSSDVATYTGCFRSGQEGGGGMLPLSGGEAVAKDSLEASPEVWHFRNTRRRMIRKKRTQNRLFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.07
4 0.06
5 0.07
6 0.09
7 0.1
8 0.1
9 0.1
10 0.1
11 0.15
12 0.15
13 0.15
14 0.13
15 0.13
16 0.12
17 0.12
18 0.12
19 0.06
20 0.05
21 0.05
22 0.04
23 0.03
24 0.03
25 0.02
26 0.02
27 0.03
28 0.03
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.06
35 0.06
36 0.06
37 0.08
38 0.1
39 0.13
40 0.14
41 0.18
42 0.19
43 0.28
44 0.38
45 0.4
46 0.49
47 0.56
48 0.66
49 0.74
50 0.83
51 0.85
52 0.87
53 0.94
54 0.94
55 0.94