Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0KGY5

Protein Details
Accession A0A2X0KGY5    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-32HNQTRKAHRNGIKKPKTNKYPSLHydrophilic
NLS Segment(s)
PositionSequence
14-44RKAHRNGIKKPKTNKYPSLKGVDPKFRRNAR
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTAHNQTRKAHRNGIKKPKTNKYPSLKGVDPKFRRNARHAAMGTQKAVAAAKAAAASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.74
3 0.74
4 0.71
5 0.72
6 0.74
7 0.79
8 0.79
9 0.78
10 0.81
11 0.82
12 0.83
13 0.8
14 0.79
15 0.76
16 0.74
17 0.7
18 0.68
19 0.6
20 0.56
21 0.55
22 0.56
23 0.52
24 0.5
25 0.54
26 0.54
27 0.57
28 0.56
29 0.59
30 0.52
31 0.57
32 0.51
33 0.49
34 0.51
35 0.48
36 0.44
37 0.36
38 0.32
39 0.24
40 0.24
41 0.18
42 0.12
43 0.09
44 0.09