Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0LJW8

Protein Details
Accession A0A2X0LJW8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-81GLALYRNTRRRMIRKKRTQNRLFGWQHydrophilic
NLS Segment(s)
PositionSequence
42-72RRNSGQRLARGKPGGLALYRNTRRRMIRKKR
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MPPIAGFSGESQSSDVATYTGCFRSGQRGGGGGGGYASVFRRRNSGQRLARGKPGGLALYRNTRRRMIRKKRTQNRLFGWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.07
4 0.07
5 0.07
6 0.09
7 0.1
8 0.1
9 0.11
10 0.11
11 0.19
12 0.21
13 0.22
14 0.2
15 0.2
16 0.2
17 0.2
18 0.19
19 0.11
20 0.09
21 0.07
22 0.06
23 0.05
24 0.06
25 0.1
26 0.11
27 0.12
28 0.16
29 0.18
30 0.26
31 0.31
32 0.41
33 0.41
34 0.48
35 0.55
36 0.53
37 0.57
38 0.52
39 0.45
40 0.37
41 0.33
42 0.27
43 0.21
44 0.21
45 0.18
46 0.27
47 0.34
48 0.38
49 0.4
50 0.44
51 0.52
52 0.61
53 0.69
54 0.7
55 0.74
56 0.8
57 0.88
58 0.92
59 0.94
60 0.92
61 0.91