Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0KQ22

Protein Details
Accession A0A2X0KQ22    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MQNCLLTKKKWSKGKVKDKANNAVVCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 4.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MQNCLLTKKKWSKGKVKDKANNAVVCDKATFDRIMKEVPTYKLISQSVLIDRMKINGSLARVAIRHLEKEGLIKPVVHHTSQLVYTRAIAAEAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.85
4 0.84
5 0.83
6 0.84
7 0.81
8 0.72
9 0.64
10 0.58
11 0.48
12 0.41
13 0.34
14 0.25
15 0.19
16 0.18
17 0.16
18 0.13
19 0.15
20 0.15
21 0.16
22 0.15
23 0.17
24 0.19
25 0.2
26 0.22
27 0.21
28 0.21
29 0.24
30 0.23
31 0.21
32 0.18
33 0.18
34 0.16
35 0.18
36 0.17
37 0.13
38 0.13
39 0.14
40 0.14
41 0.12
42 0.12
43 0.1
44 0.11
45 0.11
46 0.12
47 0.12
48 0.11
49 0.12
50 0.16
51 0.16
52 0.16
53 0.16
54 0.17
55 0.16
56 0.2
57 0.21
58 0.19
59 0.18
60 0.18
61 0.18
62 0.26
63 0.29
64 0.25
65 0.24
66 0.23
67 0.25
68 0.28
69 0.31
70 0.24
71 0.21
72 0.22
73 0.22
74 0.2