Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0KTG2

Protein Details
Accession A0A2X0KTG2   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-102RTERGYRKSMHKIPKWTKLTNRTNPLGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLFKPSLPLSVGLLWKNPWRMSQTRKMRARLRLKTVDHNIAVVEQASPSTLSLKAALALPTEASMPARDKYTTFSRTERGYRKSMHKIPKWTKLTNRTNPLGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.31
4 0.3
5 0.29
6 0.31
7 0.37
8 0.43
9 0.51
10 0.57
11 0.62
12 0.68
13 0.73
14 0.74
15 0.77
16 0.8
17 0.77
18 0.75
19 0.73
20 0.69
21 0.7
22 0.69
23 0.64
24 0.53
25 0.46
26 0.37
27 0.29
28 0.25
29 0.16
30 0.11
31 0.05
32 0.05
33 0.05
34 0.05
35 0.04
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.07
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.06
48 0.07
49 0.06
50 0.06
51 0.07
52 0.09
53 0.1
54 0.11
55 0.12
56 0.12
57 0.17
58 0.23
59 0.26
60 0.28
61 0.3
62 0.32
63 0.36
64 0.44
65 0.47
66 0.45
67 0.47
68 0.49
69 0.55
70 0.62
71 0.66
72 0.68
73 0.67
74 0.73
75 0.77
76 0.81
77 0.79
78 0.77
79 0.78
80 0.79
81 0.82
82 0.81
83 0.81