Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2X0K5Y5

Protein Details
Accession A0A2X0K5Y5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
207-232GDFKPLSKQRSRKSTRRHSAGNEPNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 5, cyto 4, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000232  HSF_DNA-bd  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF00447  HSF_DNA-bind  
Amino Acid Sequences MVSIPKAPAAAVAASTVRSSCAEWDTAAPAQQYSLSNVPKYHFELGPSPLENGPRFIGEHSRSSSWQSCSTGVALSRRRESDPPSSAVTDIQELSASAPELPPVEPTPFISKLSHILELSEHREYISIILASHHPNLLKALSQYFKYTTITSLIRQLNIYSFKRLTTTQLLDVLDLTRSTKLSASDYCGFAHPKFFRPTLGRRCSLGDFKPLSKQRSRKSTRRHSAGNEPNLGTMRHTVLSRDRSSIGYFGDLGMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.11
4 0.11
5 0.11
6 0.12
7 0.13
8 0.15
9 0.15
10 0.16
11 0.17
12 0.2
13 0.2
14 0.22
15 0.19
16 0.17
17 0.16
18 0.18
19 0.18
20 0.18
21 0.23
22 0.24
23 0.26
24 0.28
25 0.29
26 0.3
27 0.33
28 0.33
29 0.28
30 0.27
31 0.29
32 0.31
33 0.34
34 0.31
35 0.29
36 0.26
37 0.3
38 0.27
39 0.25
40 0.23
41 0.19
42 0.19
43 0.18
44 0.25
45 0.23
46 0.27
47 0.28
48 0.3
49 0.3
50 0.34
51 0.38
52 0.34
53 0.35
54 0.32
55 0.3
56 0.28
57 0.28
58 0.24
59 0.22
60 0.25
61 0.27
62 0.29
63 0.32
64 0.33
65 0.35
66 0.37
67 0.39
68 0.41
69 0.39
70 0.38
71 0.36
72 0.35
73 0.32
74 0.3
75 0.25
76 0.18
77 0.14
78 0.11
79 0.08
80 0.08
81 0.08
82 0.08
83 0.07
84 0.06
85 0.05
86 0.06
87 0.07
88 0.07
89 0.08
90 0.09
91 0.1
92 0.1
93 0.12
94 0.16
95 0.17
96 0.19
97 0.17
98 0.17
99 0.2
100 0.21
101 0.21
102 0.16
103 0.15
104 0.15
105 0.17
106 0.19
107 0.15
108 0.13
109 0.12
110 0.12
111 0.12
112 0.11
113 0.09
114 0.06
115 0.06
116 0.07
117 0.08
118 0.1
119 0.1
120 0.1
121 0.09
122 0.09
123 0.1
124 0.1
125 0.09
126 0.08
127 0.11
128 0.11
129 0.12
130 0.13
131 0.14
132 0.15
133 0.16
134 0.15
135 0.13
136 0.15
137 0.16
138 0.15
139 0.22
140 0.21
141 0.21
142 0.2
143 0.2
144 0.2
145 0.25
146 0.26
147 0.23
148 0.22
149 0.22
150 0.23
151 0.24
152 0.24
153 0.24
154 0.25
155 0.22
156 0.26
157 0.26
158 0.23
159 0.23
160 0.19
161 0.14
162 0.12
163 0.11
164 0.08
165 0.08
166 0.09
167 0.1
168 0.11
169 0.14
170 0.15
171 0.21
172 0.23
173 0.24
174 0.24
175 0.25
176 0.26
177 0.23
178 0.3
179 0.26
180 0.29
181 0.32
182 0.32
183 0.35
184 0.39
185 0.48
186 0.51
187 0.55
188 0.52
189 0.49
190 0.52
191 0.52
192 0.52
193 0.45
194 0.43
195 0.39
196 0.39
197 0.47
198 0.5
199 0.51
200 0.54
201 0.61
202 0.61
203 0.68
204 0.75
205 0.75
206 0.79
207 0.84
208 0.86
209 0.85
210 0.83
211 0.78
212 0.81
213 0.81
214 0.78
215 0.72
216 0.62
217 0.57
218 0.51
219 0.44
220 0.35
221 0.28
222 0.23
223 0.2
224 0.2
225 0.21
226 0.28
227 0.36
228 0.36
229 0.37
230 0.36
231 0.36
232 0.38
233 0.37
234 0.3
235 0.24
236 0.22