Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2X0KLJ4

Protein Details
Accession A0A2X0KLJ4   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
531-550TSTPTPKKGKWVCRQCEGKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036028  SH3-like_dom_sf  
IPR001452  SH3_domain  
Pfam View protein in Pfam  
PF00018  SH3_1  
PROSITE View protein in PROSITE  
PS50002  SH3  
CDD cd00174  SH3  
Amino Acid Sequences MSSDSEATAQGDDATRRPTLNETSPKIQQDASTLSDKMSDLSIQQHASSIKTVEETARQPSQSLQSSEATVRPLPPLPASVDPPATPLKNEPGLNSPFPPPASPSSTIALTSPDSTEARSLSVDRDASAPKQISPPPPPMSAARKPIAKLPPPPPMSAAKLSSVPPPPLASSNPALQRLPAPGFGAGAPPPLRAASSATASSPLAPPPPGGARSYAVIGPDQGWNDAPELDGVAPRTAAAARNTASRMRASRRVYPGSGASISLPPAAVSPAIPSPAVFGAVGGAAPSAYGTPAPAPTSLSDYDTAIASITSSSTALPQLSPPLPASGPALEQQQQQSSEQVLFSVKALYEYSSGVAGDLSFGAGDVLQVTAVEESGWWKGRSGAVGPSLSIPSNYVQVVLPEFEPSLSLSDTSTPFTLSPFSDPSPSTTSTTLSSHSPDLSPPALPILSSFTETQLLEKLVKRQAVSSFQSSTASTTTSSIGPVRPGATTTTTTMSTAANPYARPSTTSSSTDRPTLEDIIRFIPDPSTTSTPTPKKGKWVCRQCEGKELAPGKTRRMGEWAGWKASPSGILTKAWEHWDKYHALTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.23
5 0.26
6 0.3
7 0.37
8 0.44
9 0.47
10 0.51
11 0.57
12 0.58
13 0.55
14 0.5
15 0.42
16 0.37
17 0.35
18 0.33
19 0.31
20 0.28
21 0.26
22 0.27
23 0.26
24 0.21
25 0.18
26 0.15
27 0.13
28 0.17
29 0.21
30 0.2
31 0.2
32 0.23
33 0.22
34 0.23
35 0.24
36 0.2
37 0.17
38 0.17
39 0.18
40 0.17
41 0.22
42 0.23
43 0.27
44 0.31
45 0.3
46 0.3
47 0.32
48 0.37
49 0.38
50 0.38
51 0.35
52 0.31
53 0.34
54 0.35
55 0.33
56 0.29
57 0.24
58 0.23
59 0.23
60 0.23
61 0.23
62 0.22
63 0.23
64 0.23
65 0.25
66 0.28
67 0.28
68 0.28
69 0.26
70 0.28
71 0.3
72 0.26
73 0.25
74 0.24
75 0.27
76 0.31
77 0.32
78 0.31
79 0.33
80 0.38
81 0.38
82 0.38
83 0.34
84 0.31
85 0.32
86 0.3
87 0.27
88 0.27
89 0.3
90 0.31
91 0.3
92 0.3
93 0.29
94 0.28
95 0.25
96 0.22
97 0.18
98 0.16
99 0.14
100 0.15
101 0.15
102 0.15
103 0.16
104 0.14
105 0.14
106 0.14
107 0.15
108 0.13
109 0.17
110 0.17
111 0.16
112 0.18
113 0.2
114 0.2
115 0.25
116 0.24
117 0.21
118 0.27
119 0.31
120 0.35
121 0.37
122 0.44
123 0.42
124 0.42
125 0.43
126 0.43
127 0.46
128 0.46
129 0.48
130 0.44
131 0.44
132 0.43
133 0.48
134 0.51
135 0.49
136 0.5
137 0.5
138 0.55
139 0.54
140 0.55
141 0.5
142 0.46
143 0.45
144 0.4
145 0.35
146 0.28
147 0.27
148 0.27
149 0.3
150 0.29
151 0.26
152 0.23
153 0.23
154 0.23
155 0.23
156 0.23
157 0.22
158 0.2
159 0.25
160 0.27
161 0.28
162 0.26
163 0.25
164 0.25
165 0.25
166 0.24
167 0.2
168 0.17
169 0.15
170 0.16
171 0.15
172 0.15
173 0.11
174 0.13
175 0.12
176 0.11
177 0.12
178 0.11
179 0.11
180 0.1
181 0.13
182 0.11
183 0.13
184 0.13
185 0.13
186 0.14
187 0.14
188 0.14
189 0.12
190 0.12
191 0.11
192 0.11
193 0.11
194 0.12
195 0.15
196 0.15
197 0.15
198 0.16
199 0.15
200 0.15
201 0.17
202 0.15
203 0.13
204 0.11
205 0.11
206 0.1
207 0.11
208 0.11
209 0.1
210 0.1
211 0.1
212 0.1
213 0.1
214 0.09
215 0.07
216 0.07
217 0.06
218 0.07
219 0.07
220 0.07
221 0.07
222 0.06
223 0.07
224 0.07
225 0.09
226 0.1
227 0.11
228 0.12
229 0.15
230 0.16
231 0.17
232 0.18
233 0.18
234 0.21
235 0.24
236 0.31
237 0.33
238 0.39
239 0.44
240 0.46
241 0.44
242 0.41
243 0.37
244 0.32
245 0.28
246 0.21
247 0.16
248 0.13
249 0.12
250 0.11
251 0.09
252 0.07
253 0.06
254 0.06
255 0.05
256 0.05
257 0.06
258 0.06
259 0.07
260 0.07
261 0.06
262 0.07
263 0.07
264 0.08
265 0.06
266 0.05
267 0.05
268 0.05
269 0.05
270 0.03
271 0.03
272 0.02
273 0.02
274 0.03
275 0.02
276 0.02
277 0.02
278 0.03
279 0.04
280 0.05
281 0.06
282 0.06
283 0.07
284 0.07
285 0.11
286 0.11
287 0.12
288 0.12
289 0.11
290 0.11
291 0.11
292 0.1
293 0.07
294 0.06
295 0.04
296 0.04
297 0.04
298 0.04
299 0.04
300 0.04
301 0.05
302 0.06
303 0.06
304 0.06
305 0.06
306 0.1
307 0.1
308 0.11
309 0.11
310 0.12
311 0.11
312 0.12
313 0.13
314 0.1
315 0.1
316 0.1
317 0.12
318 0.13
319 0.14
320 0.15
321 0.17
322 0.17
323 0.17
324 0.17
325 0.15
326 0.14
327 0.12
328 0.12
329 0.09
330 0.08
331 0.08
332 0.08
333 0.07
334 0.07
335 0.08
336 0.08
337 0.08
338 0.08
339 0.09
340 0.08
341 0.08
342 0.07
343 0.06
344 0.05
345 0.05
346 0.04
347 0.04
348 0.03
349 0.03
350 0.03
351 0.03
352 0.03
353 0.03
354 0.03
355 0.03
356 0.03
357 0.03
358 0.03
359 0.03
360 0.03
361 0.03
362 0.05
363 0.08
364 0.11
365 0.1
366 0.11
367 0.13
368 0.14
369 0.15
370 0.16
371 0.16
372 0.17
373 0.17
374 0.17
375 0.17
376 0.17
377 0.15
378 0.14
379 0.12
380 0.09
381 0.11
382 0.11
383 0.1
384 0.09
385 0.1
386 0.11
387 0.11
388 0.1
389 0.09
390 0.09
391 0.08
392 0.08
393 0.08
394 0.09
395 0.08
396 0.08
397 0.08
398 0.11
399 0.12
400 0.13
401 0.13
402 0.12
403 0.11
404 0.12
405 0.14
406 0.12
407 0.14
408 0.15
409 0.16
410 0.18
411 0.19
412 0.22
413 0.25
414 0.26
415 0.25
416 0.23
417 0.23
418 0.23
419 0.23
420 0.21
421 0.18
422 0.18
423 0.18
424 0.18
425 0.17
426 0.15
427 0.18
428 0.18
429 0.16
430 0.14
431 0.14
432 0.13
433 0.12
434 0.12
435 0.13
436 0.13
437 0.15
438 0.15
439 0.14
440 0.17
441 0.17
442 0.18
443 0.15
444 0.16
445 0.17
446 0.19
447 0.24
448 0.26
449 0.29
450 0.29
451 0.3
452 0.33
453 0.37
454 0.39
455 0.37
456 0.34
457 0.33
458 0.34
459 0.3
460 0.27
461 0.21
462 0.18
463 0.14
464 0.13
465 0.14
466 0.13
467 0.14
468 0.14
469 0.15
470 0.16
471 0.17
472 0.17
473 0.15
474 0.16
475 0.17
476 0.18
477 0.19
478 0.2
479 0.21
480 0.2
481 0.2
482 0.2
483 0.18
484 0.17
485 0.17
486 0.18
487 0.18
488 0.17
489 0.2
490 0.23
491 0.23
492 0.24
493 0.26
494 0.29
495 0.31
496 0.35
497 0.37
498 0.39
499 0.41
500 0.43
501 0.38
502 0.35
503 0.34
504 0.35
505 0.33
506 0.29
507 0.29
508 0.27
509 0.28
510 0.26
511 0.23
512 0.2
513 0.18
514 0.18
515 0.21
516 0.24
517 0.25
518 0.29
519 0.38
520 0.42
521 0.49
522 0.55
523 0.51
524 0.57
525 0.64
526 0.71
527 0.72
528 0.77
529 0.76
530 0.78
531 0.84
532 0.76
533 0.76
534 0.71
535 0.63
536 0.61
537 0.58
538 0.54
539 0.54
540 0.53
541 0.49
542 0.52
543 0.5
544 0.43
545 0.45
546 0.43
547 0.4
548 0.48
549 0.49
550 0.45
551 0.44
552 0.43
553 0.38
554 0.36
555 0.32
556 0.24
557 0.23
558 0.21
559 0.22
560 0.24
561 0.26
562 0.29
563 0.34
564 0.36
565 0.35
566 0.36
567 0.39
568 0.4