Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1D6J7

Protein Details
Accession A1D6J7   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
40-62QAKSPSKRSARGQPQTPSKKRYPHydrophilic
449-472PAPTPGQPRKSHRKDSRHHPYARTBasic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR044506  CDC14_C  
IPR029260  DSPn  
IPR000340  Dual-sp_phosphatase_cat-dom  
IPR029021  Prot-tyrosine_phosphatase-like  
IPR016130  Tyr_Pase_AS  
IPR003595  Tyr_Pase_cat  
IPR000387  Tyr_Pase_dom  
IPR020422  TYR_PHOSPHATASE_DUAL_dom  
Gene Ontology GO:0000776  C:kinetochore  
GO:0120105  C:mitotic actomyosin contractile ring, intermediate layer  
GO:1990023  C:mitotic spindle midzone  
GO:0044732  C:mitotic spindle pole body  
GO:0140602  C:nucleolar ring  
GO:0005654  C:nucleoplasm  
GO:0030869  C:RENT complex  
GO:0004722  F:protein serine/threonine phosphatase activity  
GO:0004725  F:protein tyrosine phosphatase activity  
GO:0008138  F:protein tyrosine/serine/threonine phosphatase activity  
GO:0000422  P:autophagy of mitochondrion  
GO:0071470  P:cellular response to osmotic stress  
GO:0035853  P:chromosome passenger complex localization to spindle midzone  
GO:0006974  P:DNA damage response  
GO:0051229  P:meiotic spindle disassembly  
GO:1902406  P:mitotic actomyosin contractile ring maintenance  
GO:0044878  P:mitotic cytokinesis checkpoint signaling  
GO:2000786  P:positive regulation of autophagosome assembly  
GO:0031536  P:positive regulation of exit from mitosis  
GO:1903501  P:positive regulation of mitotic actomyosin contractile ring assembly  
GO:0140429  P:positive regulation of mitotic sister chromatid biorientation  
GO:1902846  P:positive regulation of mitotic spindle elongation  
GO:0031031  P:positive regulation of septation initiation signaling  
GO:0006470  P:protein dephosphorylation  
GO:0034501  P:protein localization to kinetochore  
GO:1902440  P:protein localization to mitotic spindle pole body  
GO:1904789  P:regulation of mitotic actomyosin contractile ring maintenance  
KEGG nfi:NFIA_065050  -  
Pfam View protein in Pfam  
PF00782  DSPc  
PF14671  DSPn  
PROSITE View protein in PROSITE  
PS00383  TYR_PHOSPHATASE_1  
PS50056  TYR_PHOSPHATASE_2  
PS50054  TYR_PHOSPHATASE_DUAL  
CDD cd14499  CDC14_C  
cd17657  CDC14_N  
Amino Acid Sequences MSGHMGGPGQVIEYIQDRLYLASYDSPPDPKAPFPFPLEQAKSPSKRSARGQPQTPSKKRYPVYFTADDTLFYNSFHADFGPLHIGHLYRFAVHFHEILGEPANKDRAVVFYSKSDPRSRANAACLVACYMVLIQSWPPHLALAPIAQADPPYMPFRDAGYSQADFTLTIQDVVYGVWKAKEQSLCSLSSFSLEEYEKFERVDMGDFNWITPQFLAFASPQHEPIAPIPSNTPEYAALPSTVSQVISSKLPLPFKNVLAHFATRNVGLVVRLNSELYSPSYFTALGINHIDMIFEDGTCPPLPLVRRFIKMAHEMITVKNKGIAVHCKAGLGRTGCLIGAYLIYRYGFTANEIIAFMRFMRPGMVVGPQQHWLHLNQGSFREWWFEDSMKEKLAQMQPAPITPGRASTKQRANNGPIATPPNNSHSKRSALGEIDHNEGAGTQSEEYLPAPTPGQPRKSHRKDSRHHPYARTTSGTLLMDRDMSKTEEQTRQRSSRLSNDSSESEEEIQLRMLAKRSSRSPVASPSQRSVSYSATVTASYTLTDDIHEDRENWGEAGHAAPKTPLSSKSGSGAIPVTKVRTSPRRVTDSRSASKGVRKISGRIGSTGSPTRVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.13
4 0.13
5 0.13
6 0.14
7 0.14
8 0.13
9 0.17
10 0.18
11 0.21
12 0.23
13 0.25
14 0.26
15 0.29
16 0.3
17 0.3
18 0.34
19 0.36
20 0.37
21 0.41
22 0.45
23 0.45
24 0.53
25 0.53
26 0.5
27 0.53
28 0.58
29 0.57
30 0.56
31 0.61
32 0.58
33 0.59
34 0.63
35 0.67
36 0.68
37 0.72
38 0.76
39 0.75
40 0.8
41 0.84
42 0.85
43 0.82
44 0.78
45 0.78
46 0.74
47 0.74
48 0.71
49 0.68
50 0.68
51 0.65
52 0.61
53 0.57
54 0.53
55 0.45
56 0.38
57 0.33
58 0.25
59 0.2
60 0.18
61 0.13
62 0.13
63 0.13
64 0.12
65 0.1
66 0.1
67 0.12
68 0.17
69 0.16
70 0.17
71 0.18
72 0.18
73 0.16
74 0.2
75 0.18
76 0.13
77 0.14
78 0.15
79 0.17
80 0.18
81 0.18
82 0.14
83 0.17
84 0.15
85 0.16
86 0.19
87 0.18
88 0.17
89 0.2
90 0.22
91 0.19
92 0.19
93 0.18
94 0.17
95 0.18
96 0.19
97 0.18
98 0.2
99 0.26
100 0.3
101 0.34
102 0.37
103 0.38
104 0.4
105 0.45
106 0.46
107 0.45
108 0.44
109 0.45
110 0.4
111 0.38
112 0.34
113 0.28
114 0.22
115 0.17
116 0.14
117 0.08
118 0.08
119 0.07
120 0.07
121 0.07
122 0.1
123 0.12
124 0.12
125 0.12
126 0.12
127 0.12
128 0.12
129 0.12
130 0.11
131 0.1
132 0.1
133 0.1
134 0.1
135 0.1
136 0.1
137 0.09
138 0.1
139 0.12
140 0.12
141 0.13
142 0.13
143 0.15
144 0.17
145 0.17
146 0.17
147 0.19
148 0.19
149 0.19
150 0.18
151 0.17
152 0.14
153 0.14
154 0.15
155 0.1
156 0.1
157 0.1
158 0.09
159 0.09
160 0.09
161 0.1
162 0.07
163 0.07
164 0.07
165 0.09
166 0.1
167 0.14
168 0.18
169 0.18
170 0.24
171 0.26
172 0.26
173 0.26
174 0.26
175 0.21
176 0.2
177 0.18
178 0.12
179 0.13
180 0.13
181 0.13
182 0.16
183 0.19
184 0.18
185 0.18
186 0.17
187 0.15
188 0.15
189 0.16
190 0.12
191 0.11
192 0.15
193 0.15
194 0.15
195 0.17
196 0.16
197 0.14
198 0.14
199 0.12
200 0.08
201 0.08
202 0.1
203 0.08
204 0.1
205 0.12
206 0.13
207 0.14
208 0.14
209 0.14
210 0.14
211 0.15
212 0.2
213 0.17
214 0.17
215 0.17
216 0.18
217 0.2
218 0.19
219 0.19
220 0.12
221 0.14
222 0.14
223 0.14
224 0.12
225 0.1
226 0.1
227 0.11
228 0.1
229 0.09
230 0.08
231 0.08
232 0.09
233 0.09
234 0.1
235 0.12
236 0.14
237 0.18
238 0.18
239 0.24
240 0.25
241 0.27
242 0.31
243 0.28
244 0.28
245 0.27
246 0.28
247 0.22
248 0.21
249 0.2
250 0.14
251 0.14
252 0.11
253 0.09
254 0.08
255 0.1
256 0.09
257 0.1
258 0.1
259 0.1
260 0.1
261 0.1
262 0.1
263 0.1
264 0.1
265 0.09
266 0.09
267 0.09
268 0.09
269 0.09
270 0.11
271 0.09
272 0.1
273 0.1
274 0.09
275 0.09
276 0.09
277 0.09
278 0.06
279 0.08
280 0.07
281 0.06
282 0.07
283 0.06
284 0.08
285 0.08
286 0.08
287 0.06
288 0.08
289 0.1
290 0.12
291 0.19
292 0.21
293 0.23
294 0.24
295 0.25
296 0.27
297 0.28
298 0.27
299 0.22
300 0.2
301 0.19
302 0.2
303 0.25
304 0.21
305 0.18
306 0.19
307 0.17
308 0.16
309 0.19
310 0.23
311 0.2
312 0.22
313 0.22
314 0.21
315 0.21
316 0.2
317 0.21
318 0.16
319 0.13
320 0.11
321 0.11
322 0.1
323 0.1
324 0.1
325 0.06
326 0.05
327 0.05
328 0.05
329 0.05
330 0.05
331 0.05
332 0.06
333 0.06
334 0.06
335 0.07
336 0.08
337 0.07
338 0.08
339 0.08
340 0.07
341 0.07
342 0.07
343 0.06
344 0.07
345 0.07
346 0.06
347 0.07
348 0.07
349 0.08
350 0.09
351 0.11
352 0.11
353 0.13
354 0.15
355 0.18
356 0.18
357 0.18
358 0.18
359 0.16
360 0.19
361 0.2
362 0.19
363 0.17
364 0.19
365 0.2
366 0.19
367 0.19
368 0.18
369 0.15
370 0.17
371 0.16
372 0.15
373 0.16
374 0.19
375 0.2
376 0.17
377 0.18
378 0.16
379 0.21
380 0.23
381 0.24
382 0.21
383 0.24
384 0.24
385 0.24
386 0.27
387 0.2
388 0.2
389 0.17
390 0.22
391 0.22
392 0.27
393 0.31
394 0.36
395 0.44
396 0.48
397 0.54
398 0.54
399 0.55
400 0.55
401 0.52
402 0.44
403 0.39
404 0.39
405 0.34
406 0.3
407 0.28
408 0.27
409 0.34
410 0.36
411 0.37
412 0.35
413 0.37
414 0.37
415 0.38
416 0.37
417 0.3
418 0.31
419 0.32
420 0.31
421 0.31
422 0.28
423 0.25
424 0.2
425 0.18
426 0.16
427 0.11
428 0.1
429 0.06
430 0.07
431 0.07
432 0.08
433 0.08
434 0.09
435 0.09
436 0.09
437 0.1
438 0.13
439 0.22
440 0.27
441 0.33
442 0.39
443 0.47
444 0.57
445 0.66
446 0.72
447 0.75
448 0.79
449 0.81
450 0.85
451 0.88
452 0.86
453 0.83
454 0.78
455 0.77
456 0.73
457 0.69
458 0.62
459 0.51
460 0.43
461 0.42
462 0.38
463 0.29
464 0.23
465 0.19
466 0.18
467 0.17
468 0.17
469 0.14
470 0.16
471 0.17
472 0.2
473 0.26
474 0.32
475 0.38
476 0.44
477 0.51
478 0.51
479 0.53
480 0.54
481 0.52
482 0.54
483 0.56
484 0.53
485 0.47
486 0.48
487 0.46
488 0.45
489 0.41
490 0.34
491 0.28
492 0.25
493 0.23
494 0.19
495 0.18
496 0.16
497 0.16
498 0.15
499 0.17
500 0.19
501 0.22
502 0.27
503 0.31
504 0.35
505 0.38
506 0.4
507 0.4
508 0.45
509 0.51
510 0.54
511 0.54
512 0.52
513 0.53
514 0.49
515 0.48
516 0.43
517 0.37
518 0.31
519 0.28
520 0.25
521 0.21
522 0.2
523 0.18
524 0.16
525 0.14
526 0.11
527 0.11
528 0.1
529 0.1
530 0.1
531 0.12
532 0.12
533 0.16
534 0.17
535 0.17
536 0.18
537 0.21
538 0.21
539 0.19
540 0.17
541 0.14
542 0.13
543 0.15
544 0.17
545 0.14
546 0.14
547 0.15
548 0.16
549 0.19
550 0.21
551 0.22
552 0.23
553 0.26
554 0.27
555 0.3
556 0.31
557 0.28
558 0.27
559 0.28
560 0.24
561 0.24
562 0.25
563 0.25
564 0.23
565 0.26
566 0.32
567 0.38
568 0.45
569 0.5
570 0.57
571 0.63
572 0.64
573 0.7
574 0.72
575 0.72
576 0.71
577 0.66
578 0.62
579 0.57
580 0.62
581 0.6
582 0.55
583 0.53
584 0.5
585 0.5
586 0.56
587 0.59
588 0.53
589 0.5
590 0.48
591 0.42
592 0.45
593 0.47