Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CWP4

Protein Details
Accession A1CWP4    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-32TSSHTRSSKLSLQRKKQLKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 9, nucl 2, E.R. 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008630  Glyco_trans_34  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0016757  F:glycosyltransferase activity  
GO:0048856  P:anatomical structure development  
GO:0043934  P:sporulation  
KEGG nfi:NFIA_105340  -  
Pfam View protein in Pfam  
PF05637  Glyco_transf_34  
Amino Acid Sequences MQFALPPRRSPHTSSHTRSSKLSLQRKKQLKAAAILGFAILTFFFLLSHFSHSSTASISATSGASSIVIVTVLDRARFSDNYIQKIIKNREHYASRHGYTNFFATLSDYESALDNAPRSWAIVPAMRHAMASHPHSAYFFHLDAHTLIMNPRKPLESHILDKNRLQSLMLKDVPVVPPDSIIKTFSHLKPEDVDLIISRDNEDLNPGSFVLRQGDFARFFLDMWFDPLYRKYNFQKAEMHALDHIVQWHPTVLARMALVPQRSINAYSKDSPAASADGTYKDGDLIIRFFGCDSDPKRSCEQEMEPYYNLWAKKLKST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.69
4 0.68
5 0.65
6 0.62
7 0.6
8 0.61
9 0.64
10 0.64
11 0.67
12 0.74
13 0.8
14 0.79
15 0.77
16 0.74
17 0.69
18 0.64
19 0.61
20 0.54
21 0.45
22 0.41
23 0.34
24 0.26
25 0.2
26 0.15
27 0.08
28 0.05
29 0.04
30 0.04
31 0.04
32 0.05
33 0.08
34 0.09
35 0.15
36 0.15
37 0.16
38 0.17
39 0.18
40 0.19
41 0.17
42 0.18
43 0.13
44 0.12
45 0.11
46 0.11
47 0.1
48 0.09
49 0.08
50 0.06
51 0.06
52 0.06
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.08
59 0.09
60 0.09
61 0.1
62 0.11
63 0.15
64 0.16
65 0.19
66 0.25
67 0.28
68 0.32
69 0.35
70 0.35
71 0.34
72 0.43
73 0.47
74 0.44
75 0.46
76 0.45
77 0.49
78 0.52
79 0.52
80 0.51
81 0.5
82 0.45
83 0.44
84 0.42
85 0.37
86 0.34
87 0.34
88 0.26
89 0.18
90 0.17
91 0.13
92 0.13
93 0.13
94 0.12
95 0.1
96 0.1
97 0.11
98 0.11
99 0.1
100 0.1
101 0.08
102 0.08
103 0.08
104 0.08
105 0.09
106 0.08
107 0.09
108 0.1
109 0.13
110 0.14
111 0.15
112 0.17
113 0.16
114 0.16
115 0.14
116 0.15
117 0.15
118 0.17
119 0.18
120 0.17
121 0.17
122 0.17
123 0.18
124 0.17
125 0.17
126 0.14
127 0.12
128 0.12
129 0.12
130 0.12
131 0.12
132 0.1
133 0.07
134 0.09
135 0.13
136 0.14
137 0.14
138 0.15
139 0.15
140 0.15
141 0.18
142 0.23
143 0.22
144 0.25
145 0.32
146 0.35
147 0.36
148 0.37
149 0.38
150 0.32
151 0.28
152 0.24
153 0.22
154 0.21
155 0.26
156 0.25
157 0.21
158 0.2
159 0.22
160 0.22
161 0.18
162 0.16
163 0.09
164 0.1
165 0.11
166 0.12
167 0.11
168 0.12
169 0.11
170 0.13
171 0.19
172 0.19
173 0.26
174 0.25
175 0.25
176 0.25
177 0.27
178 0.25
179 0.2
180 0.19
181 0.12
182 0.13
183 0.13
184 0.12
185 0.11
186 0.09
187 0.09
188 0.09
189 0.11
190 0.1
191 0.09
192 0.1
193 0.09
194 0.09
195 0.1
196 0.11
197 0.11
198 0.11
199 0.12
200 0.13
201 0.17
202 0.18
203 0.17
204 0.18
205 0.15
206 0.15
207 0.14
208 0.14
209 0.11
210 0.13
211 0.14
212 0.13
213 0.14
214 0.17
215 0.21
216 0.2
217 0.25
218 0.27
219 0.35
220 0.37
221 0.4
222 0.44
223 0.42
224 0.51
225 0.46
226 0.42
227 0.34
228 0.33
229 0.3
230 0.23
231 0.22
232 0.13
233 0.13
234 0.12
235 0.12
236 0.11
237 0.11
238 0.12
239 0.11
240 0.1
241 0.1
242 0.11
243 0.13
244 0.17
245 0.17
246 0.17
247 0.16
248 0.17
249 0.19
250 0.21
251 0.24
252 0.24
253 0.28
254 0.3
255 0.32
256 0.32
257 0.31
258 0.28
259 0.25
260 0.21
261 0.17
262 0.16
263 0.16
264 0.15
265 0.17
266 0.16
267 0.15
268 0.13
269 0.13
270 0.13
271 0.13
272 0.12
273 0.12
274 0.12
275 0.12
276 0.12
277 0.12
278 0.12
279 0.19
280 0.21
281 0.3
282 0.33
283 0.38
284 0.44
285 0.46
286 0.48
287 0.47
288 0.49
289 0.49
290 0.52
291 0.53
292 0.48
293 0.46
294 0.46
295 0.44
296 0.38
297 0.32
298 0.31