Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LN56

Protein Details
Accession E2LN56   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-69ADDNGTTPQRPKRKRRAEQDDVLEDHydrophilic
NLS Segment(s)
PositionSequence
36-37KG
54-60RPKRKRR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
KEGG mpr:MPER_08243  -  
Amino Acid Sequences MPPKTRASAIQTRSSTHYREQSLTTVTPARATVRRKGKPRTEAEADDNGTTPQRPKRKRRAEQDDVLEDPADTSHSVEAARLSNEELDEFFTVKRGAHVQTKSRQTSGVYPEPMSSISGTSKHRDIGSKGKQGLQASVKRLILSHVELPPTRIAASPSXPQKFPTRHCCPGVCLYSQILYSFGRIREMRGTGLPGFVWDPKLFLVNLVWKDQPRSYFSSPFREYAASGRGYLTPPGLSAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.49
3 0.46
4 0.49
5 0.44
6 0.45
7 0.44
8 0.42
9 0.42
10 0.39
11 0.36
12 0.33
13 0.28
14 0.27
15 0.26
16 0.27
17 0.29
18 0.32
19 0.38
20 0.44
21 0.52
22 0.59
23 0.68
24 0.72
25 0.75
26 0.78
27 0.77
28 0.73
29 0.7
30 0.67
31 0.63
32 0.55
33 0.46
34 0.4
35 0.32
36 0.27
37 0.23
38 0.23
39 0.25
40 0.33
41 0.42
42 0.52
43 0.62
44 0.73
45 0.81
46 0.87
47 0.89
48 0.88
49 0.86
50 0.83
51 0.76
52 0.66
53 0.57
54 0.46
55 0.35
56 0.26
57 0.18
58 0.12
59 0.08
60 0.07
61 0.06
62 0.07
63 0.07
64 0.07
65 0.09
66 0.09
67 0.09
68 0.09
69 0.1
70 0.1
71 0.1
72 0.1
73 0.08
74 0.09
75 0.09
76 0.09
77 0.08
78 0.09
79 0.09
80 0.09
81 0.1
82 0.11
83 0.13
84 0.19
85 0.23
86 0.28
87 0.34
88 0.42
89 0.43
90 0.41
91 0.39
92 0.34
93 0.36
94 0.36
95 0.34
96 0.28
97 0.26
98 0.26
99 0.25
100 0.24
101 0.19
102 0.13
103 0.08
104 0.08
105 0.11
106 0.13
107 0.14
108 0.15
109 0.16
110 0.17
111 0.18
112 0.2
113 0.26
114 0.32
115 0.36
116 0.37
117 0.38
118 0.4
119 0.39
120 0.4
121 0.36
122 0.33
123 0.3
124 0.33
125 0.3
126 0.27
127 0.26
128 0.24
129 0.2
130 0.18
131 0.19
132 0.16
133 0.18
134 0.18
135 0.2
136 0.19
137 0.18
138 0.16
139 0.12
140 0.13
141 0.13
142 0.19
143 0.25
144 0.27
145 0.3
146 0.31
147 0.35
148 0.35
149 0.41
150 0.46
151 0.46
152 0.5
153 0.5
154 0.5
155 0.5
156 0.55
157 0.5
158 0.41
159 0.34
160 0.28
161 0.26
162 0.25
163 0.21
164 0.16
165 0.13
166 0.14
167 0.16
168 0.15
169 0.2
170 0.19
171 0.22
172 0.25
173 0.26
174 0.26
175 0.24
176 0.27
177 0.22
178 0.23
179 0.2
180 0.16
181 0.16
182 0.15
183 0.18
184 0.14
185 0.14
186 0.14
187 0.16
188 0.14
189 0.14
190 0.16
191 0.19
192 0.22
193 0.24
194 0.27
195 0.27
196 0.31
197 0.34
198 0.34
199 0.32
200 0.38
201 0.4
202 0.46
203 0.48
204 0.54
205 0.54
206 0.51
207 0.49
208 0.43
209 0.38
210 0.34
211 0.35
212 0.27
213 0.24
214 0.25
215 0.24
216 0.25
217 0.25
218 0.22
219 0.17