Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1DCA8

Protein Details
Accession A1DCA8    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
188-220IRGLSRAERKERIRRNERKMRSNERRSRKSGGGBasic
NLS Segment(s)
PositionSequence
101-140KPLPTPKPPTKWELFARKKGIGKYSNKPGAALADKERRKK
181-220AAAKGSSIRGLSRAERKERIRRNERKMRSNERRSRKSGGG
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG nfi:NFIA_025410  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MTEVEMVTAASEAKPKPERLPVTVSKPTPYTFDLGYLMANDPNPLELPRSEPLNASLKAIARDGTQSLLNQLLTTCPITSSAQNGVLLTLPPPATVLPRHKPLPTPKPPTKWELFARKKGIGKYSNKPGAALADKERRKKLVYDEEKGEWVPRWGYKGKNKSDDEWLVEVKEKDWKKEEEAAAKGSSIRGLSRAERKERIRRNERKMRSNERRSRKSGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.33
4 0.42
5 0.45
6 0.45
7 0.53
8 0.52
9 0.55
10 0.6
11 0.57
12 0.51
13 0.49
14 0.45
15 0.41
16 0.36
17 0.3
18 0.22
19 0.23
20 0.21
21 0.19
22 0.18
23 0.15
24 0.15
25 0.13
26 0.13
27 0.11
28 0.1
29 0.1
30 0.11
31 0.1
32 0.11
33 0.1
34 0.15
35 0.17
36 0.2
37 0.19
38 0.19
39 0.22
40 0.27
41 0.26
42 0.24
43 0.24
44 0.23
45 0.23
46 0.23
47 0.2
48 0.14
49 0.15
50 0.14
51 0.13
52 0.12
53 0.11
54 0.12
55 0.13
56 0.12
57 0.1
58 0.1
59 0.09
60 0.09
61 0.1
62 0.08
63 0.07
64 0.09
65 0.11
66 0.11
67 0.13
68 0.14
69 0.15
70 0.15
71 0.14
72 0.13
73 0.12
74 0.11
75 0.09
76 0.09
77 0.07
78 0.07
79 0.07
80 0.07
81 0.08
82 0.13
83 0.19
84 0.21
85 0.26
86 0.28
87 0.28
88 0.34
89 0.41
90 0.47
91 0.5
92 0.55
93 0.56
94 0.61
95 0.62
96 0.62
97 0.56
98 0.51
99 0.48
100 0.5
101 0.5
102 0.51
103 0.52
104 0.51
105 0.52
106 0.49
107 0.49
108 0.46
109 0.46
110 0.46
111 0.51
112 0.52
113 0.49
114 0.47
115 0.4
116 0.36
117 0.32
118 0.28
119 0.25
120 0.28
121 0.33
122 0.38
123 0.4
124 0.39
125 0.38
126 0.39
127 0.42
128 0.44
129 0.47
130 0.46
131 0.48
132 0.47
133 0.47
134 0.44
135 0.37
136 0.26
137 0.21
138 0.18
139 0.15
140 0.18
141 0.21
142 0.28
143 0.36
144 0.45
145 0.51
146 0.58
147 0.59
148 0.57
149 0.62
150 0.58
151 0.53
152 0.47
153 0.4
154 0.32
155 0.33
156 0.3
157 0.23
158 0.28
159 0.25
160 0.27
161 0.31
162 0.33
163 0.34
164 0.42
165 0.46
166 0.45
167 0.46
168 0.45
169 0.4
170 0.37
171 0.33
172 0.25
173 0.22
174 0.16
175 0.13
176 0.13
177 0.16
178 0.22
179 0.3
180 0.38
181 0.43
182 0.51
183 0.59
184 0.67
185 0.73
186 0.78
187 0.8
188 0.82
189 0.86
190 0.88
191 0.89
192 0.89
193 0.89
194 0.9
195 0.9
196 0.91
197 0.9
198 0.9
199 0.9
200 0.86